DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B15 and Ndufb4

DIOPT Version :9

Sequence 1:NP_610985.1 Gene:ND-B15 / 36640 FlyBaseID:FBgn0033961 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_080886.1 Gene:Ndufb4 / 68194 MGIID:1915444 Length:129 Species:Mus musculus


Alignment Length:92 Identity:28/92 - (30%)
Similarity:49/92 - (53%) Gaps:9/92 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KLRQEFLKQSSNPYRHATGEGGTVFDAGLARFQAMRVSN-YEHFKPTGKSFRTGLFAVVLPIALY 83
            :|::|:|.|.::|.|.:..|     |..|.|:...|.:| |.:|:||.|:...|..|...|:..:
Mouse    42 RLKREYLLQYNDPKRVSHIE-----DPALIRWTYARSANIYPNFRPTPKNSLLGAVAGFGPLIFW 101

  Fly    84 AWALKAERDGREEKYRTGQVAYKDRQF 110
            .:..|.:||.:|...:.|::   ||:|
Mouse   102 YYVFKTDRDRKERLIQEGKL---DRKF 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B15NP_610985.1 NDUF_B4 <21..111 CDD:284608 28/91 (31%)
Ndufb4NP_080886.1 NDUF_B4 5..128 CDD:399893 28/92 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837754
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434967at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107715
Panther 1 1.100 - - LDO PTHR15469
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.