DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B15 and ndufb4

DIOPT Version :9

Sequence 1:NP_610985.1 Gene:ND-B15 / 36640 FlyBaseID:FBgn0033961 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001017036.1 Gene:ndufb4 / 549790 XenbaseID:XB-GENE-6455426 Length:128 Species:Xenopus tropicalis


Alignment Length:110 Identity:30/110 - (27%)
Similarity:56/110 - (50%) Gaps:9/110 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNEEQEFIKRKHEATLKLRQEFLKQSSNPYRHATGEGGTVFDAGLARFQAMRVSN-YEHFKPTG 66
            ||.|::...:.:.....:|::.:..|.::|:|.|..|     |..|.|:...|..| |.:|:||.
 Frog    24 LSPEQRRAEEERLALRAQLKRRYQLQLNHPHRKALVE-----DPALNRWMFARTRNIYPNFRPTP 83

  Fly    67 KSFRTGLFAVVLPIALYAWALKAERDGREEKYRTGQVAYKDRQFK 111
            |:...||...|.|:..:.:..|.:||.:|:..:.|::   :|.|:
 Frog    84 KTSLLGLVWGVGPLIFWYYVFKTDRDRKEKLIQEGKL---ERPFQ 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B15NP_610985.1 NDUF_B4 <21..111 CDD:284608 26/90 (29%)
ndufb4NP_001017036.1 NDUF_B4 3..127 CDD:369269 30/110 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434967at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15469
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.