DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B15 and Ndufb4l1-ps1

DIOPT Version :9

Sequence 1:NP_610985.1 Gene:ND-B15 / 36640 FlyBaseID:FBgn0033961 Length:113 Species:Drosophila melanogaster
Sequence 2:XP_038948469.1 Gene:Ndufb4l1-ps1 / 501886 RGDID:1560413 Length:129 Species:Rattus norvegicus


Alignment Length:91 Identity:28/91 - (30%)
Similarity:49/91 - (53%) Gaps:9/91 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LRQEFLKQSSNPYRHATGEGGTVFDAGLARFQAMRVSN-YEHFKPTGKSFRTGLFAVVLPIALYA 84
            |::|:|.|.::|...|..|     |..|.|....|.:| |.:|:||.|:...|:.|.:.|:..:.
  Rat    43 LKREYLLQYNDPKCQAHIE-----DPALIRCTYARSANVYPNFRPTPKNSPLGMVAGLGPLIFWY 102

  Fly    85 WALKAERDGREEKYRTGQVAYKDRQF 110
            :.:|.:||.:|...:.|::   ||:|
  Rat   103 YVIKTDRDRKERLIQEGKL---DRKF 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B15NP_610985.1 NDUF_B4 <21..111 CDD:284608 28/91 (31%)
Ndufb4l1-ps1XP_038948469.1 NDUF_B4 5..128 CDD:399893 28/91 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341496
Domainoid 1 1.000 42 1.000 Domainoid score I12097
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5406
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107715
Panther 1 1.100 - - O PTHR15469
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.