DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B15 and RGD1560088

DIOPT Version :9

Sequence 1:NP_610985.1 Gene:ND-B15 / 36640 FlyBaseID:FBgn0033961 Length:113 Species:Drosophila melanogaster
Sequence 2:XP_038952083.1 Gene:RGD1560088 / 499131 RGDID:1560088 Length:129 Species:Rattus norvegicus


Alignment Length:92 Identity:27/92 - (29%)
Similarity:49/92 - (53%) Gaps:9/92 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KLRQEFLKQSSNPYRHATGEGGTVFDAGLARFQAMRVSN-YEHFKPTGKSFRTGLFAVVLPIALY 83
            :|::|.|.|.::|.|..     .:.|..|.|:...|.:| |.:|:||.|:...|..|.:.|:..:
  Rat    42 QLKREHLLQYNDPKRQT-----HIKDPALIRWTYARSANVYPNFRPTPKNSLLGAVAGLGPLIFW 101

  Fly    84 AWALKAERDGREEKYRTGQVAYKDRQF 110
            .:.:|.:||.:|...:.|::   ||:|
  Rat   102 YYVIKTDRDKKERLIQEGKL---DRKF 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B15NP_610985.1 NDUF_B4 <21..111 CDD:284608 27/91 (30%)
RGD1560088XP_038952083.1 NDUF_B4 5..128 CDD:399893 27/92 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15469
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.