DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B15 and ndufb4

DIOPT Version :9

Sequence 1:NP_610985.1 Gene:ND-B15 / 36640 FlyBaseID:FBgn0033961 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_998198.1 Gene:ndufb4 / 406306 ZFINID:ZDB-GENE-040426-1973 Length:130 Species:Danio rerio


Alignment Length:110 Identity:36/110 - (32%)
Similarity:54/110 - (49%) Gaps:11/110 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NEEQEFIKRKHEATL---KLRQEFLKQSSNPYRHATGEGGTVFDAGLARFQAMRVSNYEHFKPTG 66
            |...|:.:.:.|.|.   ::::::..|.:||||....|     |..|.|:...|...|.||:|:.
Zfish    26 NLSPEYRRAEEERTALRSQMKRQYQMQLNNPYRKELIE-----DPALTRWLHARNIVYPHFRPST 85

  Fly    67 KSFRTGLFAVVLPIALYAWALKAERDGREEKYRTGQVAYKDRQFK 111
            ||...|:....||:.|..:.||.:||.|:.|...|  .|| |.||
Zfish    86 KSSLIGVAFGALPLVLLYFVLKTDRDKRDSKIDAG--TYK-RPFK 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B15NP_610985.1 NDUF_B4 <21..111 CDD:284608 30/89 (34%)
ndufb4NP_998198.1 NDUF_B4 6..129 CDD:284608 36/110 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581498
Domainoid 1 1.000 48 1.000 Domainoid score I11939
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5470
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434967at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto38800
orthoMCL 1 0.900 - - OOG6_107715
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17318
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.