DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B15 and Ndufb4

DIOPT Version :9

Sequence 1:NP_610985.1 Gene:ND-B15 / 36640 FlyBaseID:FBgn0033961 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001032415.1 Gene:Ndufb4 / 288088 RGDID:1307072 Length:129 Species:Rattus norvegicus


Alignment Length:92 Identity:28/92 - (30%)
Similarity:50/92 - (54%) Gaps:9/92 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KLRQEFLKQSSNPYRHATGEGGTVFDAGLARFQAMRVSN-YEHFKPTGKSFRTGLFAVVLPIALY 83
            :|::|:|.|.::|.|....|     |..|.|:...|.:| |.:|:||.|:...|..|.:.|:..:
  Rat    42 RLKREYLLQYNDPKRQTHIE-----DPALIRWTYARSANVYPNFRPTPKNSLLGAVAGLGPLIFW 101

  Fly    84 AWALKAERDGREEKYRTGQVAYKDRQF 110
            .:.:|.:||.:|...:.|::   ||:|
  Rat   102 YYVIKTDRDKKERLIQEGKL---DRKF 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B15NP_610985.1 NDUF_B4 <21..111 CDD:284608 28/91 (31%)
Ndufb4NP_001032415.1 NDUF_B4 5..128 CDD:399893 28/92 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341494
Domainoid 1 1.000 42 1.000 Domainoid score I12097
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5406
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434967at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107715
Panther 1 1.100 - - LDO PTHR15469
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.