DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B15 and nuo-6

DIOPT Version :9

Sequence 1:NP_610985.1 Gene:ND-B15 / 36640 FlyBaseID:FBgn0033961 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_492001.2 Gene:nuo-6 / 172438 WormBaseID:WBGene00012166 Length:172 Species:Caenorhabditis elegans


Alignment Length:107 Identity:24/107 - (22%)
Similarity:52/107 - (48%) Gaps:1/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSNEEQEFIKRKHEATLKLRQEFLKQSSNPYRHATGEGGTVFDAGLARFQAMRVSNYEHFKPTGK 67
            ||:||::.:..::.....|::|:|::..:|:.....||.|: |..:.|:.:..::..|.|:.|.:
 Worm    46 LSDEEKKAVLWRYRVKEILKKEYLRREYDPHSFKYKEGVTM-DPAMFRWYSADMTQAEFFRFTPR 109

  Fly    68 SFRTGLFAVVLPIALYAWALKAERDGREEKYRTGQVAYKDRQ 109
            :....:..|.....:|...:....|...|....|::.:.|||
 Worm   110 TVFLYVGTVFALFYIYTRLMFVPMDKSNEACLDGKLLWWDRQ 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B15NP_610985.1 NDUF_B4 <21..111 CDD:284608 20/89 (22%)
nuo-6NP_492001.2 NDUF_B4 39..155 CDD:284608 24/107 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159665
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107715
Panther 1 1.100 - - LDO PTHR15469
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.