DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10151 and Utf1

DIOPT Version :9

Sequence 1:NP_001137670.1 Gene:CG10151 / 36639 FlyBaseID:FBgn0033960 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_001124504.2 Gene:Utf1 / 681901 RGDID:1589375 Length:338 Species:Rattus norvegicus


Alignment Length:346 Identity:66/346 - (19%)
Similarity:106/346 - (30%) Gaps:112/346 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AAATYPVPSAPAQTVSNGSAATANPASATSTPGNGATNPCQSSSKKQSFVGRNPNFDTDETKLLI 81
            ||...||.::.|...|...|...:|.:..| ||:....|                :...||:||:
  Rat    25 AAGDVPVTTSDAFATSGAMADPGSPKAPVS-PGSAQRTP----------------WSARETELLL 72

  Fly    82 QLWGDPKLQRTLITTHKKH-AVICQLAAKMQEYGYHRSPEEITTRIKNLKCFYNRLKKDKECGGQ 145
            .....|.:.|:|:...::. ....:::|.:......|:|.:...|.|.|        |||....|
  Rat    73 GTLLQPAVWRSLLLDRRQALPTYRRVSAALARQQVRRTPAQCRRRYKFL--------KDKLRDSQ 129

  Fly   146 STDSEPSWKHFAEMDAIM---------TRPIFSVRPNE---------VPAPSLKYQLEQALEEHA 192
            ...|.|......::..::         .|.....||..         .|||::       :|:.|
  Rat   130 GQPSGPFDDQIRQLMGLLGDDGPPRVRRRSAGPGRPQRRGRSAFSALAPAPAV-------VEQEA 187

  Fly   193 ERRKRRLANGEELSESDNEEDDMLLSALVSKNKDTGGRKELEAGCLEADSDMNEESFSKRRKVSA 257
            |   ..||       ::|.|....|....|..|..|.|:                          
  Rat   188 E---LPLA-------AENAEPAPALRFSSSTTKSAGVRR-------------------------- 216

  Fly   258 DVEVDIGEALTSP------CIKIEPGQEVETAAATSTVEPQQEEEDDDCMILPQPKEEPIDVDAA 316
                    ..:||      .:..|||..:|   ::.|..|..:.|:        |.|.|......
  Rat   217 --------ITSSPPPTAIDTLPPEPGHTLE---SSPTPTPDHDTEN--------PNEPPGLSQGR 262

  Fly   317 DDPPIEKSSSSTTNTSTLADM 337
            ..|.:...|.:|....||..:
  Rat   263 ASPQVAPQSLNTALLQTLTHL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10151NP_001137670.1 Myb_DNA-bind_4 69..158 CDD:290549 19/89 (21%)
Utf1NP_001124504.2 PHA03247 <5..265 CDD:223021 61/326 (19%)
Myb_DNA-bind_4 79..>126 CDD:404682 11/54 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4282
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.