DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10151 and CG18766

DIOPT Version :9

Sequence 1:NP_001137670.1 Gene:CG10151 / 36639 FlyBaseID:FBgn0033960 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_001263007.1 Gene:CG18766 / 59150 FlyBaseID:FBgn0042111 Length:308 Species:Drosophila melanogaster


Alignment Length:162 Identity:28/162 - (17%)
Similarity:63/162 - (38%) Gaps:34/162 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LIQLWGDPKLQRTLITTHKKHA-VICQLAAKMQEYGYHRSPEEITTRIKNLKCFYNRLKKDKECG 143
            ||:||   |:....:.|.|::. :...:|.::...|...:..|:..::.||...|.:.:|..|  
  Fly    21 LIKLW---KVCAYELRTIKRNGHLYVAMAKQLTSLGVPVTALEVHFKVNNLTQRYRQEQKTFE-- 80

  Fly   144 GQSTDSEPSWKHFAEMDAIMTRPIFSVRPNEVPAPSLKYQLEQALEEHAERRKRRLANGEELSES 208
              :|....:||.::::|.:.                      ::|..|...:.:|:.:....|..
  Fly    81 --TTGIISTWKFYSQVDDVF----------------------KSLAAHTGYKDKRMTSASNTSSL 121

  Fly   209 DNEEDDML----LSALVSKNKDTGGRKELEAG 236
            .:..:..:    :|.....:.:|.|..:.|.|
  Fly   122 PSTSESPVWKNPMSQQEFNSNNTEGFYKTEYG 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10151NP_001137670.1 Myb_DNA-bind_4 69..158 CDD:290549 18/78 (23%)
CG18766NP_001263007.1 Myb_DNA-bind_4 10..93 CDD:404682 18/78 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4282
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22666
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.