DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10151 and Msantd1

DIOPT Version :9

Sequence 1:NP_001137670.1 Gene:CG10151 / 36639 FlyBaseID:FBgn0033960 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_997160.1 Gene:Msantd1 / 403174 MGIID:2684990 Length:278 Species:Mus musculus


Alignment Length:249 Identity:64/249 - (25%)
Similarity:107/249 - (42%) Gaps:46/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 AATANPASATSTPGNGATNPCQSSSKKQSFVGRNPNFDTDETKLLIQLWGD--PKLQRTLITTHK 98
            :|..|||.|::..  .|..|....|.:.....|..|:...|.:.|:.:|.:  .:|::|     |
Mouse    12 SAILNPAGASNMA--AAEVPGYLVSPQTEKHRRARNWTDAEMRGLMLVWEEFFDELKQT-----K 69

  Fly    99 KHAVICQ-LAAKMQEY-GYHRSPEEITTRIKNLKCFYNRLKKDKECGGQSTDSE---PSWKHFAE 158
            ::|.:.: :|:|:.|. |..|..|||..:|.|:...|.:||    |   .||||   |.|.::..
Mouse    70 RNAKVYEKMASKLFEMTGERRLGEEIKIKITNMTFQYRKLK----C---MTDSESIPPDWPYYLA 127

  Fly   159 MDAIMTRPIFS----VRPNEVPAPSLKYQLEQALEEHAERRKRRL----ANGEELSESDNEEDDM 215
            :|.|:.:...|    :...:.|.||.. |.|.:|...|:.....|    .:.|...|.|..:...
Mouse   128 IDRILAKVPESCEGKLPDGQQPGPSTS-QTEASLSPSAKSTPLYLPYTQCSYEGHFEDDRSDSSS 191

  Fly   216 LLSALVSKNKDTGGRKELEAGC---------LEADSDMNEESFSKRRKVSADVE 260
            .|.:|..::::...:|.....|         |||   |.||    :|::|..:|
Mouse   192 SLLSLKFRSEERPVKKRKMRSCHLQKKKLRLLEA---MLEE----QRRLSRAME 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10151NP_001137670.1 Myb_DNA-bind_4 69..158 CDD:290549 28/95 (29%)
Msantd1NP_997160.1 Myb_DNA-bind_4 43..125 CDD:290549 28/93 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..167 7/28 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4282
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22666
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.