DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10151 and ssp

DIOPT Version :9

Sequence 1:NP_001137670.1 Gene:CG10151 / 36639 FlyBaseID:FBgn0033960 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_648546.1 Gene:ssp / 39375 FlyBaseID:FBgn0036248 Length:368 Species:Drosophila melanogaster


Alignment Length:250 Identity:54/250 - (21%)
Similarity:92/250 - (36%) Gaps:72/250 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 KLLIQLWGDPKLQRTLITTHKKHAVICQLAAKMQEYGYHRSPEEITTRIKNLKCFYNRLKKDKEC 142
            :||::||....:.  |..:.|:..||.::..:|:..|:  :..||..:|.::...|.| :...| 
  Fly   127 ELLLELWARHCVD--LRDSRKRVQVIWKMTGEMKSLGF--TFTEIKNKIDDMGQQYRR-ESHME- 185

  Fly   143 GGQSTDSEPSWKHFAEMDAIMT--RPIFSVRP--NEVPAP-------SLKYQLEQALEEHAERRK 196
              ::|..:..|::|..|..|.:  |.|....|  ....||       |...||::.|.:....|.
  Fly   186 --KTTGHKSQWEYFETMKMIFSSDRNIIDNMPLDKSGSAPNTTSEHNSFGSQLDEPLIDRNYLRS 248

  Fly   197 RRLANGEELSESDNEEDDMLLSALVSKNKDTGGRKELEAGCLEADSDMNEESFSKRRKVSADVEV 261
            :::..||..|...||..|                        ||..|::|....|...:      
  Fly   249 QKVHPGEGDSFDMNEYAD------------------------EAQEDVDELRILKDNII------ 283

  Fly   262 DIGEALTSPCIKIEPGQEVETAAATSTVEPQQEEEDDDCMILPQPKEEPIDVDAA 316
                            :|:|   .:|||..|:..||:    |.|...:..|:..|
  Fly   284 ----------------REIE---ESSTVHSQENYEDE----LDQQNSKTEDMKIA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10151NP_001137670.1 Myb_DNA-bind_4 69..158 CDD:290549 19/79 (24%)
sspNP_648546.1 Myb_DNA-bind_4 120..198 CDD:290549 18/78 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22666
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.