DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10151 and CG10494

DIOPT Version :9

Sequence 1:NP_001137670.1 Gene:CG10151 / 36639 FlyBaseID:FBgn0033960 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_726079.1 Gene:CG10494 / 37453 FlyBaseID:FBgn0034634 Length:523 Species:Drosophila melanogaster


Alignment Length:507 Identity:96/507 - (18%)
Similarity:172/507 - (33%) Gaps:153/507 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TSTPGNGATNPCQSSSKKQSFVGRNPNFDTDETKLLIQLWGDPKLQRTLITTHKKHAVICQLAAK 109
            :.|.|:.|.:   :|....:.|.| ..:...|..||:.|.....|:..|:  .|::|.:.:|.:|
  Fly   158 SETEGDDALD---ASGSSVNIVAR-CKWAEGEVDLLLDLIHTLGLRAALL--QKRNAKVFKLLSK 216

  Fly   110 -MQEYGYHRSPEEITTRIKNLKCFYNRLKKDKECGGQSTDSEPSWKHFAEMDAIMTRPIFSVRPN 173
             |.:...|:..|::..:.:.|:..||::|         ..:..:::||..|..::.       |.
  Fly   217 EMAKRNCHKGAEKLRIKFQQLRRLYNKVK---------NGTGKTFEHFEAMRLVLD-------PT 265

  Fly   174 EVPAPSLKYQLEQALEEHAERRKRRLANGEELSESDNEEDDMLLSALVSKNKDTGGR----KELE 234
            |.         |.|.:..||..... |:..:.::||.||.|        .::.:|..    :|::
  Fly   266 EE---------EAAADAEAEAHLSS-ASDSDFNDSDEEEGD--------ASQRSGAHFWTDEEVD 312

  Fly   235 AGCLEADSDMNEESFSKRRKVSADVEVDIGEALTSPCIKIEPGQEVETAAATSTVEPQQEEED-D 298
            :..|....:....:....||.:....|.|...|....||..|.|.............:.:|.. |
  Fly   313 SFLLIIRDNGFFRALDGSRKRNFQTLVHISNILAKQDIKRTPHQLRNKLRLLCKRHREAKEHGLD 377

  Fly   299 DCMILPQPKEEPIDVDAADDPPIEKSSSSTTNTSTLADMLQGNKPSNLLPFTGANVIIPASITTT 363
            :..|||:..|.   .|.....|.|...|:      ::.:::.:|||.|.|               
  Fly   378 NVRILPRHFEL---FDELIQAPRENRESA------ISRLIRISKPSFLKP--------------- 418

  Fly   364 TAGTSATTQSSTTTSSKLQGGKISLVPANFLMQSKLPAAAGPSPMANAKGAAPQIQLLQSAINQG 428
                               .||.| ||..                :::..::....||::|    
  Fly   419 -------------------PGKPS-VPLE----------------SDSDNSSSTCDLLRAA---- 443

  Fly   429 ARLMISGSAAAPAQPSNAGLVATAPGGVKFVLVNAEQAKAAAAAAAVGKSTASLPLSTAQAQVQA 493
                                 |.:...|..:.:.||.....|..|.:          ..|.|:.|
  Fly   444 ---------------------ADSEDYVDAIEMEAEPTPIEALTAII----------EGQKQLLA 477

  Fly   494 AVQQQQQKLHQSLQQEQHHQQHIQLEK--EESRHDHEKGRKDLQTKRHMTSM 543
                |.:..::|..::|..|||..||:  |....|.|      :|.|.::.|
  Fly   478 ----QIKTTNESFLRQQREQQHQFLEQVSELMHRDRE------ETLRRISEM 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10151NP_001137670.1 Myb_DNA-bind_4 69..158 CDD:290549 19/89 (21%)
CG10494NP_726079.1 Myb_DNA-bind_4 44..123 CDD:290549
Myb_DNA-bind_4 178..257 CDD:290549 20/90 (22%)
Myb_DNA-bind_4 303..391 CDD:290549 17/90 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12111
eggNOG 1 0.900 - - E1_KOG4282
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.