DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10151 and MSANTD1

DIOPT Version :9

Sequence 1:NP_001137670.1 Gene:CG10151 / 36639 FlyBaseID:FBgn0033960 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_001036155.1 Gene:MSANTD1 / 345222 HGNCID:33741 Length:278 Species:Homo sapiens


Alignment Length:263 Identity:64/263 - (24%)
Similarity:108/263 - (41%) Gaps:55/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PVPSAPA---QTVSNGSAATANPASATSTPGNGATNPCQSSSKKQSFVGRNPNFDTDETKLLIQL 83
            |.||..|   .|.::|.||...|....|.         |:...:     |..|:...|.:.|:.:
Human     7 PGPSLSALSHPTGASGMAAAEGPGYLVSP---------QAEKHR-----RARNWTDAEMRGLMLV 57

  Fly    84 WGD--PKLQRTLITTHKKHAVICQ-LAAKMQEY-GYHRSPEEITTRIKNLKCFYNRLKKDKECGG 144
            |.:  .:|::|     |::|.:.: :|:|:.|. |..|..|||..:|.|:...|.:||    |..
Human    58 WEEFFDELKQT-----KRNAKVYEKMASKLFEMTGERRLGEEIKIKITNMTFQYRKLK----CMT 113

  Fly   145 QSTDSEPSWKHFAEMDAIMTRPIFS----VRPNEVPAPSLKYQLEQALEEHAERR----KRRLAN 201
            .|..:.|.|.::..:|.|:.:...|    :..::.|.||.. |.|.:|...|:..    .....:
Human   114 DSESAPPDWPYYLAIDGILAKVPESCDGKLPDSQPPGPSTS-QTEASLSPPAKSTPLYFPYNQCS 177

  Fly   202 GEELSESDNEEDDMLLSALVSKNKDTGGRKELEAGC---------LEADSDMNEESFSKRRKVSA 257
            .|...|.|..:....|.:|..::::...:|.....|         |||   |.||    :|::|.
Human   178 YEGRFEDDRSDSSSSLLSLKFRSEERPVKKRKVQSCHLQKKQLRLLEA---MVEE----QRRLSR 235

  Fly   258 DVE 260
            .||
Human   236 AVE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10151NP_001137670.1 Myb_DNA-bind_4 69..158 CDD:290549 25/92 (27%)
MSANTD1NP_001036155.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 8/19 (42%)
Myb_DNA-bind_4 44..125 CDD:316362 25/89 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..168 8/30 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4282
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22666
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.