DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10151 and paics

DIOPT Version :9

Sequence 1:NP_001137670.1 Gene:CG10151 / 36639 FlyBaseID:FBgn0033960 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_955831.1 Gene:paics / 321193 ZFINID:ZDB-GENE-030131-9762 Length:425 Species:Danio rerio


Alignment Length:447 Identity:86/447 - (19%)
Similarity:138/447 - (30%) Gaps:147/447 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 TRPIFSVRPNEVPAPSLKYQLEQALEEHAERR-----KRRLANGEELSESDNEEDDMLLSALVSK 223
            |:.||.:.  :.|...|....:|....:|.|:     |..:||..........:|..|.:|.|.:
Zfish    18 TKQIFEIL--DEPGHVLVQSKDQITAGNAVRKDQMEGKAAIANKTTSCVFKLLQDAGLKTAFVRQ 80

  Fly   224 NKDTG----------------------------GRKE------LEAGCLEADSDMNEESFSKRRK 254
            :.||.                            |.||      |:......|...|:..:|:.:.
Zfish    81 HSDTAFVASRCEMIPIEWVCRRIATGSFLKRNPGVKEGYRFTPLKMEMFFKDDANNDPQWSEEQL 145

  Fly   255 VSAD----------VEVDIGEALTSPCIKIEPGQEVETAAATSTVEPQQEEEDDDCMILPQPKEE 309
            ::|.          .||||....|....::     :|.|.||           .||.::      
Zfish   146 LAAGFDLAGLTIGRCEVDIMSKSTVAIFEV-----LEKAWAT-----------QDCTLV------ 188

  Fly   310 PIDVDAADDPPIEKSSSSTTNTSTLADMLQGNKPSNLLP------------FTGANVIIPAS--- 359
                    |..||...:.||....|||::. |....|.|            :.....:.|.:   
Zfish   189 --------DMKIEFGVNVTTKEIVLADVID-NDSWRLWPAGDRSQQKDKQVYRDLKEVTPEAMQM 244

  Fly   360 ---------------ITTTTAGTSATTQSSTTT---SSKLQGGKISL-VPANFLMQSKLPAAAGP 405
                           :.:...|.......||:.   ..|::....|. :|.:..:.|   |..||
Zfish   245 VKRNFEWVAERVKLLLESQARGRVVVMMGSTSDVAHCEKIRKACASYGIPCHLRVNS---AHKGP 306

  Fly   406 SPMANAKG-----AAPQIQLLQSAINQGARLMISGSAAAP------------AQPSNAGLVATAP 453
            ......|.     ..|.|.:..:..:.|...::||:.|.|            ||...:.|  ..|
Zfish   307 DETLRIKAEYEGDGEPTIFVAVAGRSNGLGPVMSGNTAYPVINCPPVTPDWGAQDIWSSL--RMP 369

  Fly   454 GGVKFVLVNAEQAKAAAAAAAVG--------KSTASLPLSTAQAQVQAAVQQQQQKL 502
            .|:....|.:.:|.|..||..:|        |..||: |:|..:..||..:.|...|
Zfish   370 SGLGCSTVLSPEAAAQFAAQILGLNNHLIWAKLRASM-LNTWVSLKQADKKMQDCSL 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10151NP_001137670.1 Myb_DNA-bind_4 69..158 CDD:290549
paicsNP_955831.1 SAICAR_synt_Ade5 7..258 CDD:133471 48/272 (18%)
purE 268..421 CDD:273474 35/158 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11643
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.