DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn6 and F59B2.15

DIOPT Version :9

Sequence 1:NP_725412.2 Gene:Rpn6 / 36638 FlyBaseID:FBgn0028689 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001254974.1 Gene:F59B2.15 / 13190661 WormBaseID:WBGene00185006 Length:119 Species:Caenorhabditis elegans


Alignment Length:43 Identity:11/43 - (25%)
Similarity:21/43 - (48%) Gaps:5/43 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 CKIMLGQSDDVNQLVSGKLAITYSG-RDIDAMKSVAEASHKRS 315
            || |:...||..:   .|.....|| :::|..:::..:|.:.|
 Worm    74 CK-MISTKDDCQE---RKQKSKDSGEKEVDTNQNLIPSSMRNS 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn6NP_725412.2 RPN6 18..438 CDD:227488 11/43 (26%)
PCI 302..406 CDD:279707 3/14 (21%)
F59B2.15NP_001254974.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.