powered by:
Protein Alignment Rpn6 and F59B2.15
DIOPT Version :9
Sequence 1: | NP_725412.2 |
Gene: | Rpn6 / 36638 |
FlyBaseID: | FBgn0028689 |
Length: | 439 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001254974.1 |
Gene: | F59B2.15 / 13190661 |
WormBaseID: | WBGene00185006 |
Length: | 119 |
Species: | Caenorhabditis elegans |
Alignment Length: | 43 |
Identity: | 11/43 - (25%) |
Similarity: | 21/43 - (48%) |
Gaps: | 5/43 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 274 CKIMLGQSDDVNQLVSGKLAITYSG-RDIDAMKSVAEASHKRS 315
|| |:...||..: .|.....|| :::|..:::..:|.:.|
Worm 74 CK-MISTKDDCQE---RKQKSKDSGEKEVDTNQNLIPSSMRNS 112
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Rpn6 | NP_725412.2 |
RPN6 |
18..438 |
CDD:227488 |
11/43 (26%) |
PCI |
302..406 |
CDD:279707 |
3/14 (21%) |
F59B2.15 | NP_001254974.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5159 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.