DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AttB and AttA

DIOPT Version :9

Sequence 1:NP_001163152.1 Gene:AttB / 36637 FlyBaseID:FBgn0041581 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_523745.1 Gene:AttA / 36636 FlyBaseID:FBgn0012042 Length:221 Species:Drosophila melanogaster


Alignment Length:221 Identity:210/221 - (95%)
Similarity:214/221 - (96%) Gaps:3/221 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQKTSILI---LALFAIAEAVPTTGPIRVRRQVLGGSLASNPAGGADARLNLSKGIGNPNHNVVG 62
            ||.|||||   :|||||.||:|||||||||||||||||.|||||||||||:|:||||||||||||
  Fly     1 MQNTSILIVALVALFAITEALPTTGPIRVRRQVLGGSLTSNPAGGADARLDLTKGIGNPNHNVVG 65

  Fly    63 QVFAAGNTQSGPVTTGGTLAYNNAGHGASLTKTHTPGVKDVFQQEAHANLFNNGRHNLDAKVFAS 127
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 QVFAAGNTQSGPVTTGGTLAYNNAGHGASLTKTHTPGVKDVFQQEAHANLFNNGRHNLDAKVFAS 130

  Fly   128 QNKLANGFEFQRNGAGLDYSHINGHGGSLTHSNFPGIGQQLGLDGRANLWSSPNRATTLDLTGSA 192
            ||||||||||||||||||||||||||.||||||||||||||||||||||||||||||||||||||
  Fly   131 QNKLANGFEFQRNGAGLDYSHINGHGASLTHSNFPGIGQQLGLDGRANLWSSPNRATTLDLTGSA 195

  Fly   193 SKWTSGPFANQKPNFGAGLGLSHHFG 218
            ||||||||||||||||||||||||||
  Fly   196 SKWTSGPFANQKPNFGAGLGLSHHFG 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AttBNP_001163152.1 Attacin_N 31..96 CDD:281725 61/64 (95%)
Attacin_C 98..217 CDD:281726 117/118 (99%)
AttANP_523745.1 Attacin_N 34..99 CDD:281725 61/64 (95%)
Attacin_C 101..220 CDD:281726 117/118 (99%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446773
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EXDN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.