DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AttB and AttC

DIOPT Version :9

Sequence 1:NP_001163152.1 Gene:AttB / 36637 FlyBaseID:FBgn0041581 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_523729.3 Gene:AttC / 36484 FlyBaseID:FBgn0041579 Length:241 Species:Drosophila melanogaster


Alignment Length:242 Identity:148/242 - (61%)
Similarity:174/242 - (71%) Gaps:25/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQKTSILILALFAIAEAV-------PTTGPI-------------RVRRQVLGGSLASNPAGGADA 45
            |.|..:||:.:..:..::       |.|.|:             |.|||||||||.|||:|||||
  Fly     1 MSKIVLLIVVIVGVLGSLAVALPQRPYTQPLIYYPPPPTPPRIYRARRQVLGGSLTSNPSGGADA 65

  Fly    46 RLNLSKGIGNPNHNVVGQVFAAGNTQ----SGPVTTGGTLAYNNAGHGASLTKTHTPGVKDVFQQ 106
            ||:|||.:|.|:|:|:||||||||||    |.|||:|.||.|||.|||..|||||||||:|.|||
  Fly    66 RLDLSKAVGTPDHHVIGQVFAAGNTQTKPVSTPVTSGATLGYNNHGHGLELTKTHTPGVRDSFQQ 130

  Fly   107 EAHANLFNNGRHNLDAKVFASQNKLANGFEFQRNGAGLDYSHINGHGGSLTHSNFPGIGQQLGLD 171
            .|.|||||||.||||||.|||||:|||||:|.||||.|||||:.|||.:|||:|.||:|:||.|.
  Fly   131 TATANLFNNGVHNLDAKAFASQNQLANGFKFDRNGAALDYSHVKGHGATLTHANIPGLGKQLELG 195

  Fly   172 GRANLWSSPNRATTLDLTGSASKWTSGPFANQKPNFGAGLGLSHHFG 218
            ||||||.|.:|.|.|||..:|||||||||..| .:.||.|||||:||
  Fly   196 GRANLWQSQDRNTRLDLGSTASKWTSGPFKGQ-TDLGANLGLSHYFG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AttBNP_001163152.1 Attacin_N 31..96 CDD:281725 48/68 (71%)
Attacin_C 98..217 CDD:281726 83/118 (70%)
AttCNP_523729.3 Attacin_N 51..120 CDD:281725 48/68 (71%)
Attacin_C 122..240 CDD:281726 83/118 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EXDN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.