powered by:
Protein Alignment AttA and DptB
DIOPT Version :9
Sequence 1: | NP_523745.1 |
Gene: | AttA / 36636 |
FlyBaseID: | FBgn0012042 |
Length: | 221 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_523787.2 |
Gene: | DptB / 37184 |
FlyBaseID: | FBgn0034407 |
Length: | 120 |
Species: | Drosophila melanogaster |
Alignment Length: | 75 |
Identity: | 29/75 - (38%) |
Similarity: | 38/75 - (50%) |
Gaps: | 15/75 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 139 EFQRNGAGLDYSHINGHGASLTHSNFPGIGQQLGLDGRANLWSSPNRATTLDLTGSASKWTSGPF 203
:||.||.| |.| |..|..|.|:|||.:|.|||...:.|.|||.::...||:
Fly 54 QFQLNGGG---------GGS------PKQGFDLSLNGRAPVWQSPNGRHSFDATGSYAQHLGGPY 103
Fly 204 ANQKPNFGAG 213
.|.:|.:|||
Fly 104 GNSRPQWGAG 113
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.