DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jef and AgaP_AGAP011747

DIOPT Version :9

Sequence 1:NP_001246323.1 Gene:jef / 36634 FlyBaseID:FBgn0033958 Length:762 Species:Drosophila melanogaster
Sequence 2:XP_001689288.1 Gene:AgaP_AGAP011747 / 5667798 VectorBaseID:AGAP011747 Length:269 Species:Anopheles gambiae


Alignment Length:291 Identity:62/291 - (21%)
Similarity:104/291 - (35%) Gaps:89/291 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 IRPEAINCIERRNATDFVLTYT----RTKRDLSAMYEQEHLD-----MGTGTMPADEALEEAEAA 252
            |.|.||.|.:.....:...||:    :.|....|..|::..|     :.....|.|:|..:|:  
Mosquito    21 IVPTAIVCADADEEDEICHTYSEGIIQVKATFDAHNEKDEGDECSYPLDGFRCPLDKAWVKAQ-- 83

  Fly   253 HSRHKRSLLLPRIDAGISP-VHINFVSNYDDKYHRDYVTPIFSSMVYRT------------PDIQ 304
                         .||..| |..:....|::.          .|::|.|            .:..
Mosquito    84 -------------PAGCKPVVQCDIADPYEES----------ESLLYGTTCDGDEDNDGDDDEGD 125

  Fly   305 KAFFLLLLVILIGEFFSAPAITLADSAVITLLGED------ADKYGHQRMFGSLGWGISMFLVGI 363
            ..|:..|.:..:.:||...|:||.:: :|.::..|      || :|.|.::|::||.|       
Mosquito   126 STFYYYLSIRSLLDFFLLSALTLLNT-IIVIVTRDRTTSGVAD-FGRQLVWGAVGWII------- 181

  Fly   364 ALDHSTSFSNHPCGAGNKEKNYNICFSIFSVL-MTCAIISASKITFKYDPIDE--QLAAQQQAQF 425
                   |.|         .:|...:.:|.:| .|.|:|..|.:.....|.:|  ||...     
Mosquito   182 -------FFN---------DDYEQPYMLFVLLYTTAAVILLSPLKMDLSPPEEWWQLRTV----- 225

  Fly   426 VDPNKRAEEESMNQLAAQLNLPSL-AVGSGS 455
              |.|.....:..:...:..||.| |:|.||
Mosquito   226 --PQKFLSVPACRKYFQRCWLPFLVAIGLGS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jefNP_001246323.1 MFS 125..187 CDD:304372
MFS 508..>681 CDD:119392
MFS_1 511..>701 CDD:284993
AgaP_AGAP011747XP_001689288.1 MFS <127..>261 CDD:328737 39/160 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3762
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.