DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12866 and ATG22

DIOPT Version :9

Sequence 1:NP_001286425.1 Gene:CG12866 / 36630 FlyBaseID:FBgn0033955 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_009892.1 Gene:ATG22 / 850319 SGDID:S000000543 Length:528 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:48/214 - (22%)
Similarity:77/214 - (35%) Gaps:66/214 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   656 MLTVLKLFDYRLLKQFEFKILVASAFLFPMGFNIPFVYSSARTTIPVEYARMIGPIIGISNLVMR 720
            |::||.:.:..|           .||:.|......|.::|::|.:.:        ||..|.:...
Yeast   357 MISVLTVVNAML-----------GAFMIPQFLATKFRWTSSQTLMYI--------IIWASFIPFY 402

  Fly   721 NILGI------LAYKRRSWTLGLCGCGLIFGGVSVLISAFYGENLIWFQFLYGFSYAVAPAVYST 779
            .|||.      |.:|...:.|.: ..||..||:|.:..:.             ||..|.|...||
Yeast   403 GILGFFFNAFGLKHKFEMFLLAI-WYGLSLGGLSAVSRSV-------------FSLIVPPGKEST 453

  Fly   780 LRGLIYVKYLGLSKLTNAFGITSLAMGMGAFIGTTIAGKLIGITGNYSAAFCFAGLCLIVSGFLK 844
            .                 |.:.|:.....:.:|..:.|.|...|.|...:|.|..|.|::|    
Yeast   454 F-----------------FSMFSITDKGSSILGPFLVGLLTDKTHNIRYSFYFFFLLLMLS---- 497

  Fly   845 LLLPLL----IKCRNRMAQ 859
              ||:|    :|...|.|:
Yeast   498 --LPVLNCLDVKRGRREAE 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12866NP_001286425.1 MFS 308..>484 CDD:119392
MFS 675..>839 CDD:119392 37/169 (22%)
ATG22NP_009892.1 MFS_Atg22_like 28..484 CDD:341036 37/176 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11360
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.