DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12866 and LOC733714

DIOPT Version :9

Sequence 1:NP_001286425.1 Gene:CG12866 / 36630 FlyBaseID:FBgn0033955 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_001037956.1 Gene:LOC733714 / 733714 -ID:- Length:425 Species:Xenopus tropicalis


Alignment Length:211 Identity:42/211 - (19%)
Similarity:76/211 - (36%) Gaps:55/211 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   685 MGFNIPFVYSSARTTI----------PVEYARMIGPIIGISNLVMRNILGILAYKRRSWTLGLCG 739
            :|.:.||:..:|...:          |..::.:..|.....||:|...:.:.|       :|||.
 Frog   210 VGKSAPFLAIAALALLDGVLQLCILRPTRFSTVDVPATPYKNLLMDPYILVAA-------VGLCI 267

  Fly   740 CGLIFGGVSVLISAFYGENLIWFQFLYGF-------SYAVAPAVYSTLRGLIYVKYLGL------ 791
            |.|.||.:...:.....|.:...::..|.       :|.:...|::.|...|....||:      
 Frog   268 CNLTFGMLETTLPIRMMETMCAPRYQLGLCFLPCIVAYFICLNVFAELAQKIGSAALGIGFGMME 332

  Fly   792 ----------------SKLTNAFGITSLAMGMGAFIGTTIAGKLIGITGNYSAAFCFAGLCLIVS 840
                            |.....:.|:.:|:.:|..:|.:..|.:....|       |..| :|:.
 Frog   333 TSVMPLMAHLVDLRHTSNYGGIYAISDIALCIGYALGPSCGGAIAKAVG-------FKWL-MIIL 389

  Fly   841 GFLKLLL-PLLIKCRN 855
            |.:.|:. ||.|..||
 Frog   390 GIINLVFAPLFILLRN 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12866NP_001286425.1 MFS 308..>484 CDD:119392
MFS 675..>839 CDD:119392 34/192 (18%)
LOC733714NP_001037956.1 MFS_1 94..370 CDD:284993 29/166 (17%)
2_A_01_02 96..237 CDD:273318 4/26 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.