DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12860 and CG12861

DIOPT Version :9

Sequence 1:NP_610979.1 Gene:CG12860 / 36629 FlyBaseID:FBgn0033954 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_610978.2 Gene:CG12861 / 36628 FlyBaseID:FBgn0033953 Length:239 Species:Drosophila melanogaster


Alignment Length:258 Identity:69/258 - (26%)
Similarity:92/258 - (35%) Gaps:80/258 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RDRRHSHTDGVSDKCAKNKKDKRECKKFESENAKKPECKPPVVRAPKYYKQLKPCKTDKELSELH 128
            |.||..|...:       |:....|.|..|.|.||  |.|||:..||.                 
  Fly    35 RRRRLEHLKEL-------KRLDEMCYKAASRNDKK--CHPPVLPLPKM----------------- 73

  Fly   129 PKYLGVWGRCDIPYKPEPDC-TDPC-DLAVRLDDKYYKPSKSLDREFDQYWVECFF----RKQKR 187
                              :| .||| :..:.||..:|.||....|::.:.|.||:.    ..:.|
  Fly    74 ------------------ECIDDPCAESEMPLDLDHYTPSDKAARKYQRTWCECYMIPKAAVKAR 120

  Fly   188 CCRKVAPERTY---RVLTKKCVSAPKKAPCFTVNPMPCKQEAKTS------------PCPKIKLC 237
            .|....|.|.:   ||...:|          ..:||||....|..            ||.||...
  Fly   121 KCYPNRPRRKFECPRVSDVEC----------RWDPMPCDDVKKKPEILIEVPRIGKWPCCKIPTP 175

  Fly   238 ECPPAAAINNCKLVRRHTRCRRRACQYPSFSECQHEELNTSRPIECRCLEVPPLCLVY---RH 297
            .|.......:|...|..|.|::|..:|||||||:.|.|:...|  |.|.:...:|.||   ||
  Fly   176 GCRDGRIPPSCDAGRIPTCCKKRRTKYPSFSECKKELLDPIPP--CECEKKVNMCDVYAYFRH 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12860NP_610979.1 DM6 148..298 CDD:214775 52/174 (30%)
CG12861NP_610978.2 DM6 74..235 CDD:214775 50/172 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451822
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F9I4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.