DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12860 and boly

DIOPT Version :9

Sequence 1:NP_610979.1 Gene:CG12860 / 36629 FlyBaseID:FBgn0033954 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_610373.2 Gene:boly / 35809 FlyBaseID:FBgn0050362 Length:255 Species:Drosophila melanogaster


Alignment Length:243 Identity:67/243 - (27%)
Similarity:96/243 - (39%) Gaps:60/243 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 AKNKKDKRECKKFESENAKKP--------------ECK-PPVVRAPKYYKQLKPCKTDKELSELH 128
            |..:||.:  |...::|.|.|              :|: .|....|.:....|.|.:|       
  Fly    43 ATERKDLK--KNDPADNTKVPVKDICWMSMRRSEYKCRSDPEFNVPAFIDSRKRCLSD------- 98

  Fly   129 PKYLGVWGRCDIPYKPEPDCTDPCDLAVRLDDKYYKPSKSLDREFDQYWVECFF--RKQKRCCRK 191
                    ||.:.|.|.             |..:|||:..|:|::.:.|.||..  ||:|..||.
  Fly    99 --------RCAMAYPPS-------------DLMFYKPTDKLNRKYQRTWCECELQERKRKAVCRS 142

  Fly   192 VAPE---RTYRVL----TKKCVSAPKKAPCFTVNPMPCKQEAKTSPCPKIKLCECPPAAAINNCK 249
            ..|:   |:.|.|    :|.|....|........|.|.|     |.||:.|:..|..|.. ..|:
  Fly   143 RPPKIHRRSLRTLPLHPSKVCSKGNKSLGLGLCRPKPAK-----SSCPRFKMPFCKQAIT-TGCR 201

  Fly   250 LVRRHTRCRRRACQYPSFSECQHEELNTSRPIECRCLEVPPLCLVYRH 297
            ..|..:.|.|...:||||||||...|....|..|.|:..||:|:|:.:
  Fly   202 PGRPPSNCVRPRTKYPSFSECQPYPLPDVPPTHCFCINQPPMCVVWNY 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12860NP_610979.1 DM6 148..298 CDD:214775 50/159 (31%)
bolyNP_610373.2 DM6 94..251 CDD:214775 56/190 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451826
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F9I4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.