DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12860 and CG11635

DIOPT Version :9

Sequence 1:NP_610979.1 Gene:CG12860 / 36629 FlyBaseID:FBgn0033954 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_610372.1 Gene:CG11635 / 35808 FlyBaseID:FBgn0033283 Length:286 Species:Drosophila melanogaster


Alignment Length:286 Identity:73/286 - (25%)
Similarity:97/286 - (33%) Gaps:84/286 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SQVDRRFAHSDDRCANKKSRKCEQSPPKGVGLPPRDRRHSHTDGVSDKCAKNKKDKRECKKFESE 94
            |.:.|.|:......:||..:  ..||||    ||.          |....|:...|||||     
  Fly     4 SSLLRGFSSRQSGSSNKPPK--PPSPPK----PPS----------SPSPPKSPSAKRECK----- 47

  Fly    95 NAKKPECKPPV--VRAPKYYKQLKPCKTDKELSELHPKYLGVWGR-----CDIPYKPEPDCTDPC 152
              .:..|.|..  ....|:.....|.|      .|.|.|..|..|     |      ||:||.|.
  Fly    48 --IRTHCIPAAFCAEGDKFKSMWDPPK------NLPPPYPFVVSRSNDLCC------EPNCTKPL 98

  Fly   153 DLAVRLDDKYYKPSKSLDREFDQYWVEC--FFRKQKRCC-----------RKVAPERTYRVLTKK 204
            .   ..|:.||:|| ..:..:.::||||  |..::|..|           |:||..|....|:  
  Fly    99 P---SFDELYYRPS-CKNGPYQRHWVECPKFMIRKKIICAYDKLEALSPARRVAERRERTTLS-- 157

  Fly   205 CVSAPKKAPCFTVNPMPCKQEAKTSPCPKI-KLCECPPAAAINNCKLVRRHTRCRRRACQYPSFS 268
                                ...|.|||.. .|..|.|......|...:..:.|||.....|.:|
  Fly   158 --------------------ATATGPCPHFAPLARCVPGRRPPRCHAAKTPSCCRRLCAPMPCWS 202

  Fly   269 ECQHEEL--NTSRPIECRCLEVPPLC 292
            :|:..:|  ...||.||.|.....||
  Fly   203 DCKQPKLAKRPYRPRECECRFPLSLC 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12860NP_610979.1 DM6 148..298 CDD:214775 42/161 (26%)
CG11635NP_610372.1 DM6 88..235 CDD:214775 45/173 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451835
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.