DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12860 and hubl

DIOPT Version :9

Sequence 1:NP_610979.1 Gene:CG12860 / 36629 FlyBaseID:FBgn0033954 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001286194.1 Gene:hubl / 246567 FlyBaseID:FBgn0050364 Length:291 Species:Drosophila melanogaster


Alignment Length:243 Identity:63/243 - (25%)
Similarity:94/243 - (38%) Gaps:58/243 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 ECKKFESENAKKPECKP--PVVR--------APKYY------KQLKPCKTDKELSELHPKYLGVW 135
            :||.     .||..|.|  |.||        .|:|.      ....||....:.:    |::.:|
  Fly    46 DCKV-----VKKRPCSPTDPPVRPCSEEGCTQPRYSCCVSTGISANPCADPSKKT----KFVSMW 101

  Fly   136 GRC--DIPYKPE------PDCTDPCDLAVRLDDKYYKPSKSLDREFDQYWVECFFRKQKRCCRKV 192
            .|.  |...:||      .:|...|: ..|.|..||.||... |||.:.|.|        ||.|:
  Fly   102 KRYKDDGSNRPEAMWHYPEECCPKCE-DTRFDVLYYTPSDKC-REFQRTWWE--------CCPKM 156

  Fly   193 APERTY--------RVLTKKCVSAPKKAPCFTVNP---MPCKQEAKTSPCPKIKLCECPPAAAIN 246
            .|:|..        .||.:.....|:.| |...:.   ..|..: :...|.:|::..|..|....
  Fly   157 VPKRVCCWCDAIPPEVLRRDLPICPRSA-CLAEHERKRYKCLNK-RYKGCMRIRMPCCRTARIPP 219

  Fly   247 NCKLVRRHTRCRRRACQYPSFSECQHEE--LNTSRPIECRCLEVPPLC 292
            :|:.....:.|.:..|.:||:|||..|:  :..:||.||.||:....|
  Fly   220 DCRAFPGPSDCEKIKCPFPSYSECVQEDPAVIPTRPPECECLKKASQC 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12860NP_610979.1 DM6 148..298 CDD:214775 44/158 (28%)
hublNP_001286194.1 DUF1431 126..275 CDD:284625 43/154 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451814
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F9I4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.