DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12860 and cola

DIOPT Version :9

Sequence 1:NP_610979.1 Gene:CG12860 / 36629 FlyBaseID:FBgn0033954 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_724673.1 Gene:cola / 246566 FlyBaseID:FBgn0050363 Length:259 Species:Drosophila melanogaster


Alignment Length:214 Identity:61/214 - (28%)
Similarity:92/214 - (42%) Gaps:48/214 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 DGVSDKCAKNK-KDKRECKKFESENAKKPECKPPVVRAP-KYYKQLKPCKTDKELSELHPKYL-G 133
            |..|.:|.|.: ||...||.      .|..|  ||...| |.|:  ||....:|.|:    || .
  Fly    29 DASSGECCKMRDKDTTACKD------GKWFC--PVKYEPNKCYE--KPSFAVEEYSQ----YLQE 79

  Fly   134 VWGRCDIPYKPEPDCTDPCDLAVRLDDKYYKPSKSLDREFDQYWVEC---FFRKQKRCCRKVAPE 195
            ::.|    .|..|||...   .:|.|.::||||.. .|:|.:.|.||   :.|.:..||   ..:
  Fly    80 IYNR----GKTNPDCLLK---LIRHDAEHYKPSDK-QRKFQRTWPECPLLWLRPKDYCC---PDQ 133

  Fly   196 RTYRVLTKKCVSAPKKAPCFTVN------PMPCKQEAKTSPCPKIKLCECPPAAAINNCKLVRRH 254
            ..|:.:.:: :..|::.|...:.      .:.||  :..:||.|:.  ..||     .|...||.
  Fly   134 EVYQPMNRR-IRPPQEPPLSAIEKHLFQMSIFCK--SVRAPCCKVG--RRPP-----KCTKPRRP 188

  Fly   255 TRCRRRACQYPSFSE-CQH 272
            :.|.::....||||| |:|
  Fly   189 SECCKKFTPMPSFSEACRH 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12860NP_610979.1 DM6 148..298 CDD:214775 36/135 (27%)
colaNP_724673.1 DM6 84..232 CDD:214775 39/141 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451834
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.