DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12861 and CG2127

DIOPT Version :9

Sequence 1:NP_610978.2 Gene:CG12861 / 36628 FlyBaseID:FBgn0033953 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_610375.2 Gene:CG2127 / 35811 FlyBaseID:FBgn0033286 Length:305 Species:Drosophila melanogaster


Alignment Length:251 Identity:82/251 - (32%)
Similarity:106/251 - (42%) Gaps:77/251 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GSLTIKRTYDTVKKMNLRRRRLEHLKELKRLDEMCYKAASRNDKKCHPPVLP--------LPKME 74
            |....|.|.....|...|:::.|..||                 |.:.|.||        :|..|
  Fly    87 GPARFKGTICDAVKGGKRKKKEEPKKE-----------------KSNKPKLPAKMRSMWYIPDCE 134

  Fly    75 CIDDPCAESEMPLDLDHYTPSDKAARKYQRTWCECYMIPKAAVKARK-C-YPNRPRRKFEC---- 133
            .:  |..:..:..|:.||..|||.||:||.||.||   |:..:|.:| | :..|||.| .|    
  Fly   135 YV--PKCDVPVRYDIQHYRISDKEARQYQVTWNEC---PRLVIKPKKVCIHAKRPRPK-PCRRQR 193

  Fly   134 -----------PRVSDVECR--WDPMPCDDVKKKPEILIEVPRIGKW--PCCKIPTPGCRDGRIP 183
                       |.::.:||:  .|..||             ||   |  ||||       ..|||
  Fly   194 KTVVATARPTMPMLNPMECKKAEDSSPC-------------PR---WTLPCCK-------PARIP 235

  Fly   184 PSCDAGRIPTCCKKRRTKYPSFSECKKELLDPIPPCECE-KKVNM-CDVYAYFRHK 237
            |||...|.||.|.||...||||||||:|.|...||.||. .:|.| |:::|..|.:
  Fly   236 PSCHRERRPTDCTKRPAPYPSFSECKREELTNAPPTECLCLRVPMACEMWAELRRR 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12861NP_610978.2 DM6 74..235 CDD:214775 68/183 (37%)
CG2127NP_610375.2 DUF1431 133..290 CDD:284625 68/185 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451823
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.