DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12861 and boly

DIOPT Version :9

Sequence 1:NP_610978.2 Gene:CG12861 / 36628 FlyBaseID:FBgn0033953 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_610373.2 Gene:boly / 35809 FlyBaseID:FBgn0050362 Length:255 Species:Drosophila melanogaster


Alignment Length:221 Identity:73/221 - (33%)
Similarity:103/221 - (46%) Gaps:40/221 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KELKRLD----------EMCYKAASRNDKKCH-PPVLPLP-----KMECIDDPCAESEMPLDLDH 91
            |:||:.|          ::|:.:..|::.||. .|...:|     :..|:.|.||.:..|.||..
  Fly    47 KDLKKNDPADNTKVPVKDICWMSMRRSEYKCRSDPEFNVPAFIDSRKRCLSDRCAMAYPPSDLMF 111

  Fly    92 YTPSDKAARKYQRTWCECYMIPKAAVKARKCYPNRPRRKFEC----PRVSDVECRWDPM----PC 148
            |.|:||..||||||||||      .::.||       ||..|    |::.....|..|:    .|
  Fly   112 YKPTDKLNRKYQRTWCEC------ELQERK-------RKAVCRSRPPKIHRRSLRTLPLHPSKVC 163

  Fly   149 DDVKKKPEILIEVPRIGKWPCCKIPTPGCRDGRIPPSCDAGRIPTCCKKRRTKYPSFSECKKELL 213
            ....|...:.:..|:..|..|.:...|.|:.. |...|..||.|:.|.:.||||||||||:...|
  Fly   164 SKGNKSLGLGLCRPKPAKSSCPRFKMPFCKQA-ITTGCRPGRPPSNCVRPRTKYPSFSECQPYPL 227

  Fly   214 DPIPP--CECEKKVNMCDVYAYFRHK 237
            ..:||  |.|..:..||.|:.|:|.|
  Fly   228 PDVPPTHCFCINQPPMCVVWNYYRMK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12861NP_610978.2 DM6 74..235 CDD:214775 61/170 (36%)
bolyNP_610373.2 DM6 94..251 CDD:214775 61/170 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451820
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F9I4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.