DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12861 and cola

DIOPT Version :9

Sequence 1:NP_610978.2 Gene:CG12861 / 36628 FlyBaseID:FBgn0033953 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_724673.1 Gene:cola / 246566 FlyBaseID:FBgn0050363 Length:259 Species:Drosophila melanogaster


Alignment Length:262 Identity:69/262 - (26%)
Similarity:90/262 - (34%) Gaps:94/262 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KMNLRRRRLEHLKELKR---------LDEMCYKAASRNDKKCHP-----PVLPLPKMECIDDP-- 79
            |:.|||.::.......|         ....|.|...::...|..     ||...|. :|.:.|  
  Fly     5 KLRLRRAQIPRFSITSRWYNWGSYDASSGECCKMRDKDTTACKDGKWFCPVKYEPN-KCYEKPSF 68

  Fly    80 ---------------------CAESEMPLDLDHYTPSDKAARKYQRTWCEC---YMIPKAAVKAR 120
                                 |....:..|.:||.|||| .||:||||.||   ::.||     .
  Fly    69 AVEEYSQYLQEIYNRGKTNPDCLLKLIRHDAEHYKPSDK-QRKFQRTWPECPLLWLRPK-----D 127

  Fly   121 KCYP--------NRPRRKFECPRVSDVECRWDPMP--CDDVKKKPEILIEVPRIGKWPCCKIPTP 175
            .|.|        ||..|..:.|.:|.:|.....|.  |..|:.              ||||:   
  Fly   128 YCCPDQEVYQPMNRRIRPPQEPPLSAIEKHLFQMSIFCKSVRA--------------PCCKV--- 175

  Fly   176 GCRDGRIPPSCDAGRIPTCCKKRRTKYPSFSECKKELLDPIPP-------------CECEKKVNM 227
                ||.||.|...|.|:.|.|:.|..|||||..:.|   ||.             ||.....||
  Fly   176 ----GRRPPKCTKPRRPSECCKKFTPMPSFSEACRHL---IPRFCGSECACRGGSLCEMWNTYNM 233

  Fly   228 CD 229
            |:
  Fly   234 CN 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12861NP_610978.2 DM6 74..235 CDD:214775 58/205 (28%)
colaNP_724673.1 DM6 84..232 CDD:214775 53/177 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451838
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.