DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-E and Adal

DIOPT Version :9

Sequence 1:NP_610977.1 Gene:Adgf-E / 36627 FlyBaseID:FBgn0033952 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_011238139.1 Gene:Adal / 75894 MGIID:1923144 Length:396 Species:Mus musculus


Alignment Length:371 Identity:87/371 - (23%)
Similarity:140/371 - (37%) Gaps:99/371 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 EENLRKYLQMRFSMYP-LASFTTNAHAWRHMMGIFGLLDGLLQYAPVWGDYYYNALKEFYADGVQ 262
            ::..::.||..|.|:. :...||:|             :.:|....       :.:|||..|||:
Mouse    55 DKGKKRTLQECFQMFQVIHQLTTSA-------------EDILMVTK-------DVIKEFADDGVK 99

  Fly   263 YLEVRSVLPQLYSLDGSRMPKRETVQIYKDTLERFKKEHPGFIDSKLIYAPIRHVQPELVGEYIK 327
            |||:||. |:..:..|  |.::..|:...:.:::.|:|:.. ||.:.:.|..|...|.:.    :
Mouse   100 YLELRST-PREENATG--MTRKTYVESVLEGIKQCKQENLD-IDVRYLMAIDRRGGPTIA----R 156

  Fly   328 ECTELNKEF----PSFVVGFDLVGQEDVG------HPLSNFAAELLKLPDHIHFYFHAGQTNWYG 382
            |..||.|||    .:.|:|.||.|...:|      .||.......|||..|:....:..:.|   
Mouse   157 ETVELAKEFFLSTENTVLGLDLSGDPTIGQANDFLEPLLEAKKAGLKLALHLAEIPNREKEN--- 218

  Fly   383 SHVDQNLLDAIVLGTKRIGHG--------------------------------YTITKHPVLMR- 414
                |.||..:   ..|||||                                |.....|:|:| 
Mouse   219 ----QMLLSLL---PDRIGHGTFLSASEAGALDQVDFVRQHQIPLVLEANAELYMCRAGPLLLRH 276

  Fly   415 -------LAKYLNIALEVCPVSNQVLQLGSDYRSHPAATLIAENVPMVIASGSPGFWRAAPLSHD 472
                   .::.:||..|:|..||...|....|..|......:...|.||.:...|.: |..||.:
Mouse   277 IPTQNKSTSQVMNILWELCLTSNIKSQTVPSYDQHHFGFWYSIAHPSVICTDDKGVF-ATYLSQE 340

  Fly   473 FYMA--FLGIAPMNA-DLKFLKRTAKNSIKYSSLKDEAKAEAMEKW 515
            :.:|  ...:.|... ||.:      .||.|....|..::|..::|
Mouse   341 YQLAAETFNLTPFQVWDLSY------ESINYIFACDNTRSELRKRW 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-ENP_610977.1 A_deaminase_N 46..125 CDD:285627
adm_rel 52..527 CDD:273620 87/371 (23%)
ADGF 105..519 CDD:238646 87/371 (23%)
AdalXP_011238139.1 ADA_AMPD 17..380 CDD:238250 86/369 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R23
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.