DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-E and ada

DIOPT Version :9

Sequence 1:NP_610977.1 Gene:Adgf-E / 36627 FlyBaseID:FBgn0033952 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_031749914.1 Gene:ada / 496434 XenbaseID:XB-GENE-950501 Length:365 Species:Xenopus tropicalis


Alignment Length:318 Identity:79/318 - (24%)
Similarity:127/318 - (39%) Gaps:49/318 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 AWRHMMGIFGLLDGLLQYAP-VWGD--------YYYNALKEFYADGVQYLEVR---------SVL 270
            :::..:.:...|.....|.| :.||        |.:..:|.  .:||.|:|||         .|.
 Frog    57 SYKEPLSLTEFLSKFNHYMPAIAGDREAIKRIAYEFVEMKA--KEGVIYVEVRYSPHFLANSKVE 119

  Fly   271 PQLYSLDGSRMPKRETVQIYKDTLERFKKEHPGFIDSKLIYAPIRHVQPELVGEYIKECTELNKE 335
            |..:......:...|.|.:....|.:.:|...  |.::.|...:||: |....|.::.|.:...:
 Frog   120 PIPWGQKEGDITPDEVVDLVNQGLRKGEKAFN--IKARSILCCMRHM-PSWSTEVVELCKKYQND 181

  Fly   336 FPSFVVGFDLVGQEDV------GHPLSNFAAELLKLPDHIHFYFHAGQTNWYGSHVDQNLLDAIV 394
               .||..||.|.|.:      ||  .....|.:|.  .||...|||:..  .|.|.:..::  |
 Frog   182 ---TVVAIDLAGDESLNCESYPGH--RKAYEEAVKC--GIHRTVHAGEVG--PSSVVKEAVE--V 235

  Fly   395 LGTKRIGHGYTITKHPVLMRLAKYLNIALEVCPVSNQVLQLGS---DYRSHPAATLIAENVPMVI 456
            |..:||||||..|:.|.|.:.....|:..||||.|:.:  .|:   |:..|||.....:.....:
 Frog   236 LKAERIGHGYHTTEDPNLYKELLEKNMHFEVCPWSSYL--TGACHPDFTKHPATQFRKDKANYSL 298

  Fly   457 ASGSPGFWRAAPLSHDFYMAFLGIAPMNADLKFLKRTAKNSIKYSSLKDEAKAEAMEK 514
            .:..|..: .:.|..|:.:|   ...|....:..||...|:.|.|.|.:..|.|.:.|
 Frog   299 NTDDPLIF-GSTLDVDYSIA---AKHMGFTEEEFKRVNINAAKSSFLPESEKKELLYK 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-ENP_610977.1 A_deaminase_N 46..125 CDD:285627
adm_rel 52..527 CDD:273620 79/318 (25%)
ADGF 105..519 CDD:238646 79/318 (25%)
adaXP_031749914.1 ADA 17..353 CDD:238645 79/318 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R23
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.