DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-E and ada

DIOPT Version :9

Sequence 1:NP_610977.1 Gene:Adgf-E / 36627 FlyBaseID:FBgn0033952 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001002646.1 Gene:ada / 436919 ZFINID:ZDB-GENE-040718-393 Length:362 Species:Danio rerio


Alignment Length:390 Identity:85/390 - (21%)
Similarity:154/390 - (39%) Gaps:97/390 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 AKDKPK-----------------DVSFENGEWQPM---EKLRELRGEENLRKYLQMRFSMYPLAS 217
            |.||||                 ||:...|...|:   |:|:||             .::...|:
Zfish     9 AFDKPKVELHVHLDGAIRLKTVLDVAKRRGISLPVSMEEELKEL-------------CTVNEPAT 60

  Fly   218 FTTNAHAWRHMMGIF-GLLDGLLQYAPVWGDYYYNALKEFYADGVQYLEVR---------SVLPQ 272
            .|.....:.|.|.:. |..:.:.:.|       |..::....:||.|:|.|         .|.|.
Zfish    61 LTEFLGKFSHFMHVIAGDREAIKRIA-------YEFVETKAKEGVIYVEARYSPHFLANKGVEPL 118

  Fly   273 LYSLDGSRMPKRETVQI----YKDTLERFKKEHPGFIDSKLIYAPIRHVQPELVGEYIKECTELN 333
            .:......:...:.|.:    :|:..:.||.:      ::.|...:||: |....|.::.|.:.:
Zfish   119 PWDQKPGDITPDDVVDLVNQGFKEGEQAFKTK------ARSILCCMRHM-PNWSMEVVELCKKFH 176

  Fly   334 KEFPSFVVGFDLVGQEDV------GHPLSNFAAELLKLPDHIHFYFHAGQTNWYGSHVDQNLLDA 392
            |:   .||..||.|.|.:      ||..:...|    :..::|...|||:..  .:.|.:..:: 
Zfish   177 KD---GVVAIDLAGDESMNCESYPGHKKAFEEA----VRSNVHRTVHAGEVG--PASVVREAVE- 231

  Fly   393 IVLGTKRIGHGYTITKHPVLMRLAKYLNIALEVCPVSNQVLQLGS---DYRSHPAATLIAENVPM 454
             ||..:||||||...:...|.:...:.|:..|:||||:::  .|:   |:..||..|...:....
Zfish   232 -VLKAERIGHGYHTLEDQNLYKQLLHQNMHFEMCPVSSRL--TGACEPDFTKHPLITFKKDKANY 293

  Fly   455 VIASGSPGFWRAAPLSHDF-----YMAFLGIAPMNADLKFLKRTAKNSIKYSSLKDEAKAEAMEK 514
            .:.:..|..:.:. |:.|:     ||.|       .:.:| ||...|:.|...|.::.|.:.:.:
Zfish   294 SLNTDDPTIFNST-LNSDYEVVQKYMDF-------TEEEF-KRLNINAAKSCFLPEKEKEKLLNQ 349

  Fly   515  514
            Zfish   350  349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-ENP_610977.1 A_deaminase_N 46..125 CDD:285627
adm_rel 52..527 CDD:273620 85/390 (22%)
ADGF 105..519 CDD:238646 85/390 (22%)
adaNP_001002646.1 ADA 11..350 CDD:238645 84/388 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R23
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.