DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-E and adah-1

DIOPT Version :9

Sequence 1:NP_610977.1 Gene:Adgf-E / 36627 FlyBaseID:FBgn0033952 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_501087.1 Gene:adah-1 / 177469 WormBaseID:WBGene00015551 Length:391 Species:Caenorhabditis elegans


Alignment Length:285 Identity:65/285 - (22%)
Similarity:115/285 - (40%) Gaps:47/285 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 YNALKEFYADGVQYLEVRSVLPQLYSLDGSRMPKRETVQIYKDTLERFKKEHPGFIDSKLIYAPI 314
            |...::.:.:||.|.|.|.....|...|...:.....|...|...:|.:|:..  |.::.|...|
 Worm   125 YELCEDQHNNGVVYFEGRYSPHLLLCNDYPEVTAAHVVAAVKKGFDRGEKQFG--IKARSILCCI 187

  Fly   315 RHVQ---PELVGEYIKECTELNKEFPSFVVGFDLVGQEDVGHPLSNFAAELLKLPD--------H 368
            |.:.   |:|:.:...:..:|.      ||..|:.|        |...|:....|:        |
 Worm   188 RGLDKKFPQLILDLATDLKQLG------VVAIDVAG--------SAHGADEQYEPEVVAAFQEAH 238

  Fly   369 ---IHFYFHAGQTNWYGSHVDQNLLDAIV-LGTKRIGHGYTITK--HPVLMRLAKYLNIALEVCP 427
               ||...|||:     |...:.::.||. :..:||||||.:.:  ...|.......|:.||.||
 Worm   239 KRGIHRTVHAGE-----SGGPKEVIKAIEDMYAERIGHGYRVMRDEEMYLEHFVNSKNVHLEACP 298

  Fly   428 VSNQVLQLGS---DYRSHPAATLIAENVPMVIASGSPGFWRAAPLSHDFYMAFLGIAPMNADLKF 489
            .|:  :..|:   |:::||.|....::|...::...|..:..:.||.    ..|....:..|:..
 Worm   299 YSS--VMTGAVPLDWKNHPIARWAKDDVNFSVSRDDPTCFDNSMLSE----LTLVHKQIGLDVHQ 357

  Fly   490 LKRTAKNSIKYSSLKDEAKAEAMEK 514
            |.:...|:.:...|.::.|||.:::
 Worm   358 LWKAQLNAARSCFLPEDEKAELVKR 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-ENP_610977.1 A_deaminase_N 46..125 CDD:285627
adm_rel 52..527 CDD:273620 65/285 (23%)
ADGF 105..519 CDD:238646 65/285 (23%)
adah-1NP_501087.1 ADA 48..383 CDD:238645 65/285 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R23
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.