DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-E and Ada

DIOPT Version :9

Sequence 1:NP_610977.1 Gene:Adgf-E / 36627 FlyBaseID:FBgn0033952 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001258981.1 Gene:Ada / 11486 MGIID:87916 Length:352 Species:Mus musculus


Alignment Length:385 Identity:95/385 - (24%)
Similarity:151/385 - (39%) Gaps:97/385 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 KPKDVSF---ENGEWQPMEKLRELRGEENLRKYLQM-----RFSMYPLASFTTNAHAWRHMMGIF 232
            ||:.:.:   :.|...|.:.:.|||....:.|.|.:     :|..|              |..|.
Mouse    23 KPETILYFGKKRGIALPADTVEELRNIIGMDKPLSLPGFLAKFDYY--------------MPVIA 73

  Fly   233 GLLDGLLQYAPVWGDYYYNALKEFYADGVQYLEVRSVLPQLYS---LDGSR---MPKRET----- 286
            |..:.:.:.|     |.:..:|.  .:||.|:|||      ||   |..|:   ||..:|     
Mouse    74 GCREAIKRIA-----YEFVEMKA--KEGVVYVEVR------YSPHLLANSKVDPMPWNQTEGDVT 125

  Fly   287 ----VQIYKDTLERFKKEHPGFIDSKLIYAPIRHVQPELVGEYIKECTELNKEFPSFVVGFDLVG 347
                |.:....|:  :.|....|..:.|...:|| ||....|.::.|.:.|::   .||..||.|
Mouse   126 PDDVVDLVNQGLQ--EGEQAFGIKVRSILCCMRH-QPSWSLEVLELCKKYNQK---TVVAMDLAG 184

  Fly   348 QEDV-GHPLSNFAAELLKLPDHIHFY-----------FHAGQTNWYGS-HVDQNLLDAIVLGTKR 399
            .|.: |..|         .|.|:..|           .|||:.   || .|.:..:|  :|.|:|
Mouse   185 DETIEGSSL---------FPGHVEAYEGAVKNGIHRTVHAGEV---GSPEVVREAVD--ILKTER 235

  Fly   400 IGHGY-TITKHPVLMRLAKYLNIALEVCPVSNQVLQLGSDYRSHPAATLIAENVPMVIASGSPGF 463
            :|||| ||....:..||.|. |:..||||.|:.:........:|.......:.....:.:..|..
Mouse   236 VGHGYHTIEDEALYNRLLKE-NMHFEVCPWSSYLTGAWDPKTTHAVVRFKNDKANYSLNTDDPLI 299

  Fly   464 WRAAPLSHDFYMAFLGIAPMNADLKF----LKRTAKNSIKYSSLKDEAKAEAMEKWKKQW 519
            :::. |..|:.|.       ..|:.|    .||...|:.|.|.|.:|.|.|.:|:..:::
Mouse   300 FKST-LDTDYQMT-------KKDMGFTEEEFKRLNINAAKSSFLPEEEKKELLERLYREY 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-ENP_610977.1 A_deaminase_N 46..125 CDD:285627
adm_rel 52..527 CDD:273620 95/385 (25%)
ADGF 105..519 CDD:238646 95/383 (25%)
AdaNP_001258981.1 ADA 8..336 CDD:238645 90/368 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R23
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.