DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10139 and l(2)05714

DIOPT Version :9

Sequence 1:NP_610976.1 Gene:CG10139 / 36626 FlyBaseID:FBgn0033951 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_723031.1 Gene:l(2)05714 / 46066 FlyBaseID:FBgn0010607 Length:271 Species:Drosophila melanogaster


Alignment Length:245 Identity:58/245 - (23%)
Similarity:112/245 - (45%) Gaps:37/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KIYKQKLRDVWLQMEEFRAWLRRDPDDSYRAHCRFCKCCVNTKISDLRAHASTKKH---MKHLNL 63
            ::|.|:.|..|.:..|..:|| ...:|.|.|||:.|...|..:::.::.|.:|:||   .|:.|:
  Fly    15 RLYHQRYRTEWEKYPELSSWL-ASSNDGYSAHCKICDINVLARLASIKQHLATRKHQESFKYHNI 78

  Fly    64 --KQQIK---TTDD----------SPLNRSSASSSSTTPYKVKVKSQPKTSPVKKE-KISASDQS 112
              |..||   ..|:          ||..:..|.|.:....|.:.|.|||   :|.: |:.:.::.
  Fly    79 LAKNMIKGELVKDEHDPDLEASIISPKAKPKAKSKTYPRQKPRSKMQPK---IKNDTKVESMEEE 140

  Fly   113 VDYEEIIENLAL----------YEPEQVMFSSCSL-TGGGEQRLED-DVEGEGEMSTISIMDEEM 165
            .:.:||..|.::          |:.::....:..| ....|..|:| :|..|.||..:...|.|:
  Fly   141 TEEDEIASNDSILDDLLRTDQPYQEQEFEVENEFLEVQQNETDLQDQEVVYEEEMIQLKPEDTEI 205

  Fly   166 VNKAVANALRTQKDSSQ--IFGDFVADRLRQLNTDASEFAKDKIMKVILE 213
            .|:...:|:......|:  :||..:|.:|..::.:.:...::::..|:.|
  Fly   206 NNEYQVDAMTEDTIISEFDLFGKSLALQLNNMDLEDALMCQERLQVVLTE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10139NP_610976.1 pylS 33..>206 CDD:236555 46/205 (22%)
l(2)05714NP_723031.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452812
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.