DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Had2 and AT3G15290

DIOPT Version :9

Sequence 1:NP_610974.1 Gene:Had2 / 36624 FlyBaseID:FBgn0033949 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_188147.1 Gene:AT3G15290 / 820760 AraportID:AT3G15290 Length:294 Species:Arabidopsis thaliana


Alignment Length:283 Identity:69/283 - (24%)
Similarity:123/283 - (43%) Gaps:37/283 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QKIGIVGSGLIGRAWAMLFAAAGYRVQLYDILESQLATALQELDKDLHRLEEQSALRGNIRASEQ 68
            :.:|:||:|.:|...|.|.|.:|..|.|.|.....|:.|...:...:.|...:..:...: ..:.
plant     5 KSVGVVGAGQMGSGIAQLAATSGLDVWLMDADRDALSRATAAISSSVKRFVSKGLISKEV-GDDA 68

  Fly    69 FALIGVTTRLEELTREAVHIQECVPEVLHLKKSLYSQLDELLEEQTVVASSTSTFMPSLYSEGLQ 133
            ...:.:|:.||:|....: |.|.:.|...:||.|:..||.:.:...::||:||:...:..:...:
plant    69 MHRLRLTSNLEDLCSADI-IVEAIVESEDIKKKLFKDLDGIAKSSAILASNTSSISITRLASATR 132

  Fly   134 KRQQMLVAHPLNPPYFIPLVEIVPAPWTSPSAVERTRDLMLSLGQRPVTLKREIQGFATNRIQYA 198
            :..|::..|.:|||..:.||||:....||......|:.|....|:..| ..::..||..|||...
plant   133 RPSQVIGMHFMNPPPIMKLVEIIRGADTSEETFLATKVLAERFGKTTV-CSQDYAGFVVNRILMP 196

  Fly   199 ILNEVWRLVGSGILSVADVD-----------------------------RVLSQGLG-LRYA--- 230
            ::||.:..:.:|:.:..|:|                             :||.:||| .:||   
plant   197 MINEAFHTLYTGVATKEDIDSGMKHGTNHPMGPLELADLIGLDVCLSVMKVLHEGLGDSKYAPCP 261

  Fly   231 -LLGSLETAHLNAPGGVADYFQR 252
             |:..::...|....||..|..|
plant   262 LLVQYVDAGRLGRKRGVGVYDYR 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Had2NP_610974.1 PRK06129 5..312 CDD:235706 69/282 (24%)
3HCDH_N 5..184 CDD:280833 46/178 (26%)
3HCDH 189..>256 CDD:279114 23/98 (23%)
AT3G15290NP_188147.1 PLN02545 1..294 CDD:215300 69/283 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1250
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 110 1.000 Inparanoid score I2067
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.