DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Had2 and hadh

DIOPT Version :9

Sequence 1:NP_610974.1 Gene:Had2 / 36624 FlyBaseID:FBgn0033949 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001003515.1 Gene:hadh / 445121 ZFINID:ZDB-GENE-040801-261 Length:309 Species:Danio rerio


Alignment Length:238 Identity:61/238 - (25%)
Similarity:104/238 - (43%) Gaps:31/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IGIVGSGLIGRAWAMLFAAAGYRVQLYDILESQLATALQELDKDLHRLEEQSALRGNIRASEQFA 70
            :.::|.||:|...|.:.|:.|:.|.|.|.....|..:.:.::..|.|:           |.::||
Zfish    25 VTVIGGGLMGAGIAQVAASTGHSVVLVDTSADILNKSAKGIENSLKRV-----------AKKKFA 78

  Fly    71 -------------LIGVTTRLEELTREAVH----IQECVPEVLHLKKSLYSQLDELLEEQTVVAS 118
                         |..|:|..:  ....||    :.|.:.|.|.:|:.|:..||::..|.|:.||
Zfish    79 EKPEDGEAFVQKVLKNVSTSTD--AASVVHGTDLVVEAIVENLKVKQDLFGALDKVAPEHTIFAS 141

  Fly   119 STSTFMPSLYSEGLQKRQQMLVAHPLNPPYFIPLVEIVPAPWTSPSAVERTRDLMLSLGQRPVTL 183
            :||:...:..:....:..:....|..||...:.|||::..|.||....:...:...:||:.||:.
Zfish   142 NTSSLPIADIASCTARLDRFGGLHFFNPVPMMKLVEVIKTPATSQQTFDALLEFSKALGKHPVSC 206

  Fly   184 KREIQGFATNRIQYAILNEVWRLVGSGILSVADVDRVLSQGLG 226
            | :..||..||:....:.|..||...|..|..|:|..:..|.|
Zfish   207 K-DTPGFIVNRLLVPYMLEAVRLHERGHGSKEDIDVAMKLGAG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Had2NP_610974.1 PRK06129 5..312 CDD:235706 61/238 (26%)
3HCDH_N 5..184 CDD:280833 47/194 (24%)
3HCDH 189..>256 CDD:279114 13/38 (34%)
hadhNP_001003515.1 FadB 20..307 CDD:224170 61/238 (26%)
3HCDH_N 24..209 CDD:280833 48/197 (24%)
3HCDH 211..308 CDD:279114 13/38 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1250
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.