DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Had2 and HADH

DIOPT Version :9

Sequence 1:NP_610974.1 Gene:Had2 / 36624 FlyBaseID:FBgn0033949 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001171634.3 Gene:HADH / 3033 HGNCID:4799 Length:331 Species:Homo sapiens


Alignment Length:273 Identity:68/273 - (24%)
Similarity:119/273 - (43%) Gaps:24/273 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IGIVGSGLIGRAWAMLFAAAGYRVQLYDILESQLATALQELDKDLHRLEEQSALRGNIRASEQF- 69
            :.::|.||:|...|.:.||.|:.|.|.|..|..||.:.:.:::.|.::.::. ...|::|.::| 
Human    30 VTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKK-FAENLKAGDEFV 93

  Fly    70 ----ALIGVTTRLEELTREAVHIQECVPEVLHLKKSLYSQLDELLEEQTVVASSTSTFMPSLYSE 130
                :.|..:|....:......:.|.:.|.|.:|..|:.:||:...|.|:.||:||:...:..:.
Human    94 EKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIAN 158

  Fly   131 GLQKRQQMLVAHPLNPPYFIPLVEIVPAPWTSPSAVERTRDLMLSLGQRPVTLKREIQGFATNRI 195
            ...::.:....|..||...:.|||::..|.||....|...|...:||:.||:.| :..||..||:
Human   159 ATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCK-DTPGFIVNRL 222

  Fly   196 QYAILNEVWRLV----------GSGI-------LSVADVDRVLSQGLGLRYALLGSLETAHLNAP 243
            ....|.|..||.          .||:       .|..|:|..:..|.|........|:...|:..
Human   223 LVPYLMEAIRLYERDFQTCGDSNSGLGFSLKGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTT 287

  Fly   244 GGVADYFQRFGGE 256
            ..:.|.:.....|
Human   288 KFIVDGWHEMDAE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Had2NP_610974.1 PRK06129 5..312 CDD:235706 68/273 (25%)
3HCDH_N 5..184 CDD:280833 48/182 (26%)
3HCDH 189..>256 CDD:279114 18/83 (22%)
HADHNP_001171634.3 FadB 27..330 CDD:224170 68/273 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1250
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 1.028321 Normalized mean entropy S3790
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.