DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Had2 and Hadh

DIOPT Version :9

Sequence 1:NP_610974.1 Gene:Had2 / 36624 FlyBaseID:FBgn0033949 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_476534.1 Gene:Hadh / 113965 RGDID:69321 Length:314 Species:Rattus norvegicus


Alignment Length:228 Identity:67/228 - (29%)
Similarity:111/228 - (48%) Gaps:11/228 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IGIVGSGLIGRAWAMLFAAAGYRVQLYDILESQLATALQELDKDLHRLEEQSALRGNIRASEQF- 69
            :.::|.||:|...|.:.||.|:.|.|.|..|..||.:.:.:::.|.|:.::. ...|.:|:::| 
  Rat    30 VTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLKRMAKKK-FTENPKAADEFV 93

  Fly    70 --ALIGVTTRLEELTREAVH----IQECVPEVLHLKKSLYSQLDELLEEQTVVASSTSTFMPSLY 128
              .|..::|..:  ....||    :.|.:.|.|.||..|:.:||:...|.|:.||:||:...:..
  Rat    94 EKTLSSLSTSTD--AASVVHSTDLVVEAIVENLKLKNELFQRLDKFAAEHTIFASNTSSLQITNI 156

  Fly   129 SEGLQKRQQMLVAHPLNPPYFIPLVEIVPAPWTSPSAVERTRDLMLSLGQRPVTLKREIQGFATN 193
            :....::.:....|..||...:.|||::..|.||....|...|...:||:.||:.| :..||..|
  Rat   157 ANATTRQDRFAGLHFFNPVPMMKLVEVIKTPMTSQKTFESLVDFCKTLGKHPVSCK-DTPGFIVN 220

  Fly   194 RIQYAILNEVWRLVGSGILSVADVDRVLSQGLG 226
            |:....|.|..||...|..|..|:|..:..|.|
  Rat   221 RLLVPYLIEAIRLHERGDASKEDIDTAMKLGAG 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Had2NP_610974.1 PRK06129 5..312 CDD:235706 67/228 (29%)
3HCDH_N 5..184 CDD:280833 52/184 (28%)
3HCDH 189..>256 CDD:279114 14/38 (37%)
HadhNP_476534.1 FadB 27..313 CDD:224170 67/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1250
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.