DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)2-HP2 and IBSP

DIOPT Version :9

Sequence 1:NP_610972.2 Gene:Su(var)2-HP2 / 36621 FlyBaseID:FBgn0026427 Length:3257 Species:Drosophila melanogaster
Sequence 2:NP_004958.2 Gene:IBSP / 3381 HGNCID:5341 Length:317 Species:Homo sapiens


Alignment Length:292 Identity:54/292 - (18%)
Similarity:116/292 - (39%) Gaps:67/292 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1179 ISQSTERKQLLNENPSKKDKKTEQSGNKKEAVVGPLDKTETSSSTNIIDKKSNESFDSAMQ---- 1239
            :..|::..:...::.|:::::.|::.|:.|.                 :::|||..||..:    
Human    60 VQGSSDSSEENGDDSSEEEEEEEETSNEGEN-----------------NEESNEDEDSEAENTTL 107

  Fly  1240 PSDRLNQKESA-----FTKLSSISSPKKIMKDQDKDLDALSKGGDSNPTIRDTGEDSRQTDKKHQ 1299
            .:..|...|.|     :|.|::|..||              |.||    |.:.....:::|::.:
Human   108 SATTLGYGEDATPGTGYTGLAAIQLPK--------------KAGD----ITNKATKEKESDEEEE 154

  Fly  1300 ENDTKHEEEDSSKLKANIDETK------SSSEKDAE----PISKDSSQDSAKPRLSKPKSRNKRK 1354
            |.:..:|.|:|   :|.:||.:      |::..:||    ....|:.::..:..::...:.:..:
Human   155 EEEEGNENEES---EAEVDENEQGINGTSTNSTEAENGNGSSGGDNGEEGEEESVTGANAEDTTE 216

  Fly  1355 KNEKKPNDSIAESDIEGGFQVNT-ETVQATCSTPSESNKKDMVKSDETNEEPNLSETEIGRIRKR 1418
            ...:....|...:...|||:..| ..|..|.|.|  ..|...|:.:...|....:|.:.|.    
Human   217 TGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPP--FGKTTTVEYEGEYEYTGANEYDNGY---- 275

  Fly  1419 GQAFHIEN--PKDDLHITPQNENQSIAGVNFE 1448
             :.:..||  |:.|.:...::|.....|..::
Human   276 -EIYESENGEPRGDNYRAYEDEYSYFKGQGYD 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)2-HP2NP_610972.2 MDN1 <596..845 CDD:227596
PTZ00449 <739..1091 CDD:185628
PTZ00108 <1132..1374 CDD:240271 37/213 (17%)
PTZ00121 <1720..>2291 CDD:173412
IBSPNP_004958.2 BSP_II 17..314 CDD:283165 54/292 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..254 43/233 (18%)
cell-attachment tripeptide 286..288 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.