DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)2-HP2 and Muc18B

DIOPT Version :10

Sequence 1:NP_610972.2 Gene:Su(var)2-HP2 / 36621 FlyBaseID:FBgn0026427 Length:3257 Species:Drosophila melanogaster
Sequence 2:NP_573365.1 Gene:Muc18B / 32913 FlyBaseID:FBgn0031000 Length:308 Species:Drosophila melanogaster


Alignment Length:195 Identity:46/195 - (23%)
Similarity:69/195 - (35%) Gaps:41/195 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 NRGATMEEKSANCRDGEGEPVKRKR-GRPRKIIPKEEAKTAETENTIESLNTNVPLSID--TSKE 559
            |...:..||.|....|..|.|.... |...|:       |.|...|.|.:.|..|.:.:  |::.
  Fly    95 NLDESTTEKPATEAPGTTEKVTTAAPGTTEKV-------TTEAPGTTEKITTEAPGTTEKITTEA 152

  Fly   560 NPETETVNLEVPIKQDELVSDLDNAKELTGSTNLPQDDIEMASNHQETDLKCAPDRVALDKSEST 624
            ...||.:..|.|...:::.:      |..|:|..|..|....:....||   ||.  ..:|||:|
  Fly   153 PGTTEKITTEAPGTTEKITT------EAPGTTEKPATDAPGTTEKPATD---APG--TTEKSETT 206

  Fly   625 PKVEEEQLCKVDTPSDTALDESKVSESAKNHIELEDKDKDKEETQKESPNGNSKETNENSVIVTN 689
                       |.|..|  |:|.......:       :....||..:.||..:.|:.|.:.|..|
  Fly   207 -----------DAPGTT--DKSDTDAPITD-------EPSTAETSTDEPNTETTESGEETTIEDN 251

  Fly   690  689
              Fly   252  251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)2-HP2NP_610972.2 PspC_subgroup_1 <503..>842 CDD:468201 45/190 (24%)
PTZ00449 <739..1091 CDD:185628
PTZ00108 <1132..1374 CDD:240271
PRK05901 1624..>1822 CDD:235640
PTZ00121 <1671..2360 CDD:173412
Muc18BNP_573365.1 CBM_14 26..72 CDD:426342
motB <90..208 CDD:183756 33/141 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.