DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12868 and CG33468

DIOPT Version :9

Sequence 1:NP_610971.2 Gene:CG12868 / 36620 FlyBaseID:FBgn0033945 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_995837.1 Gene:CG33468 / 2768833 FlyBaseID:FBgn0053468 Length:172 Species:Drosophila melanogaster


Alignment Length:173 Identity:84/173 - (48%)
Similarity:120/173 - (69%) Gaps:11/173 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTNSVTDKNTEGDY-NLDEEIDSHLRKLFCLKPKAETPKLNPYI---VEFFGVLSLTDLRAPQR 61
            |||::|...|:.  | :|::.::.:||.:||||   |....|.||   ||:||||||:|:|||:|
  Fly     1 MTTSAVEAPNSA--YPDLEKRLERYLRSVFCLK---EIDTKNEYIPTEVEYFGVLSLSDVRAPRR 60

  Fly    62 KLWVIYHAKQPDLDKTVDEIHEKYGKKNMFDLYRTPVFSGVALRDSVRKHFSNLKWFTTGNLLEA 126
            |||.:|:|....:|||||:||.|||:|||::|:|.||::|..:|..|:.||..|||...||:|||
  Fly    61 KLWYMYYATTDQVDKTVDQIHRKYGQKNMYELFRKPVYTGAGMRSRVKNHFKGLKWHVKGNILEA 125

  Fly   127 PPKSHFNDERVVKTITDLHHLEHQRLYNYVMVK-NMW-SMRYR 167
            |..|..|||:||.||.||:..|.:|.::|:|.: |:: |..||
  Fly   126 PLGSSLNDEKVVNTIADLYQNERRRYFDYLMSRSNLYKSCTYR 168



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468455
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F7ST
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016611
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.