DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and RBM39

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_909122.1 Gene:RBM39 / 9584 HGNCID:15923 Length:530 Species:Homo sapiens


Alignment Length:323 Identity:66/323 - (20%)
Similarity:97/323 - (30%) Gaps:138/323 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DREPLSSGRLHCSARYKHKRSASSS-------SAGTTSSGHKDRRSDYDYCGSRRHQRSSSRRRS 59
            |...|||...|.....|.|:|.|.|       |........:||.........|:..||..||||
Human    18 DENKLSSANGHEERSKKRKKSKSRSRSHERKRSKSKERKRSRDRERKKSKSRERKRSRSKERRRS 82

  Fly    60 RSRS----------------------------------------------SSESPPPE------P 72
            ||||                                              ..:||..|      |
Human    83 RSRSRDRRFRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVREPIDNLTP 147

  Fly    73 RHRSGRS-----------SRDRE------------RMHKSREHPQA------------------- 95
            ..|..|:           .||.|            ||...|...::                   
Human   148 EERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIG 212

  Fly    96 ---SRCIG---------------------------------VFGLNTNTSQHKVRELFNKYGPIE 124
               .|.:|                                 |..|:.|.::..:|.:|..:|.||
Human   213 LTGQRVLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIE 277

  Fly   125 RIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYL 187
            .||:::|::|.||:|:.||.|.....|:.|.:..:|.|:.||.::|. .:|:|....:...:|
Human   278 SIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKVG-HVTERTDASSASSFL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 27/111 (24%)
RBM39NP_909122.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..146 27/127 (21%)
SF-CC1 46..518 CDD:273721 56/295 (19%)
Interaction with JUN. /evidence=ECO:0000250|UniProtKB:Q8VH51 291..406 14/50 (28%)
Activating domain. /evidence=ECO:0000250|UniProtKB:Q8VH51 291..355 14/50 (28%)
Interaction with ESR1 and ESR2. /evidence=ECO:0000250|UniProtKB:Q8VH51 355..406
Interaction with NCOA6. /evidence=ECO:0000250|UniProtKB:Q8VH51 406..530
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.