DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and HRB1

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_014394.2 Gene:HRB1 / 855728 SGDID:S000004949 Length:454 Species:Saccharomyces cerevisiae


Alignment Length:213 Identity:52/213 - (24%)
Similarity:72/213 - (33%) Gaps:58/213 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GSRRHQRSSSRRRS--RSRSSSESPPPEPRHRSGRSSRDRERMHKSREHPQASRCIGVFGLNTNT 108
            ||..:.||.||.||  |.|.|.:.......|.|.||.....| .|..:..:.||..|.:......
Yeast     7 GSENNNRSRSRSRSPVRRRMSDDHGYERDNHLSRRSGNYNGR-RKFADTYRGSRDRGEYRGGRER 70

  Fly   109 SQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFS 173
            |.::.||.||            :....|||       ::..|.|..:|      |.||       
Yeast    71 SDYRERERFN------------NRDNPRSR-------DRYDDRRRGRD------VTGR------- 103

  Fly   174 ITQRAHTPTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASPYDNYRDRYDY-------RNDRYD 231
                        |..|  |...||||..|...|  .|.....:.:...|.||       .:..|:
Yeast   104 ------------YGNR--RDDYPRSFRSRHNTR--DDSRRGGFGSSGARGDYGPLLARELDSTYE 152

  Fly   232 RNLRRSPSRNRYTRNRSY 249
            ..:.|:.|.:.:..|.:|
Yeast   153 EKVNRNYSNSIFVGNLTY 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 39/174 (22%)
RRM_TRA2 98..175 CDD:240809 15/76 (20%)
HRB1NP_014394.2 PRK12678 <29..>85 CDD:237171 14/68 (21%)
RRM1_HRB1_GBP2 160..236 CDD:410184 3/11 (27%)
RRM2_HRB1_GBP2 262..334 CDD:410185
RRM3_HRB1_GBP2 374..452 CDD:410186
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.