DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and ZCRB1

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_149105.3 Gene:ZCRB1 / 85437 HGNCID:29620 Length:217 Species:Homo sapiens


Alignment Length:107 Identity:25/107 - (23%)
Similarity:46/107 - (42%) Gaps:23/107 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 TNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRV 170
            ||...:::   |:|||.:.::.::.|..|::|:|..||.|.....|:....:.:..::.||.|:.
Human    22 TNNDLYRI---FSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRAINNKQLFGRVIKA 83

  Fly   171 DFSITQRAHTPTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRS 212
            ..:|                ..|:|.....    ||.|.|:|
Human    84 SIAI----------------DNGRAAEFIR----RRNYFDKS 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 17/68 (25%)
ZCRB1NP_149105.3 RRM_ZCRB1 9..84 CDD:409827 17/64 (27%)
PTZ00368 <97..123 CDD:173561 5/13 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..217
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.