DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and RBP47C'

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_175181.1 Gene:RBP47C' / 841159 AraportID:AT1G47500 Length:434 Species:Arabidopsis thaliana


Alignment Length:102 Identity:27/102 - (26%)
Similarity:47/102 - (46%) Gaps:11/102 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PQASRCIGVFGLNTNTSQHKVRELFN-KYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKD 156
            |..|..:|  .|..:.|...:.|.|: ||..::..::|:||.|.||:|:.|:.|...::...|..
plant   197 PDLSIFVG--DLAPDVSDALLHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAMT 259

  Fly   157 SCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQPRG 193
            ..:|::...|.:|:.        ..||....|.|.:|
plant   260 EMNGVKCSSRAMRIG--------PATPRKTNGYQQQG 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 21/79 (27%)
RBP47C'NP_175181.1 RRM1_SECp43_like 104..186 CDD:409780
RRM2_SECp43_like 198..277 CDD:409781 21/88 (24%)
RRM3_NGR1_NAM8_like 305..376 CDD:409782
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.