DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and RSZ21

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_564208.1 Gene:RSZ21 / 838997 AraportID:AT1G23860 Length:187 Species:Arabidopsis thaliana


Alignment Length:187 Identity:50/187 - (26%)
Similarity:72/187 - (38%) Gaps:38/187 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIE-VD 164
            |..|:...::.::.:.|..:|.:..:.:     .:|..|:.|:.|:   |.|.|.|:.|.:: .:
plant     6 VGNLDPRVTERELEDEFKAFGVLRNVWV-----ARRPPGYAFLEFD---DERDALDAISALDRKN 62

  Fly   165 GRRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRS----------FSP--RRGRRVYHDRSASPYD 217
            |.|:.:       :|....|...|...||....|          |:.  ||||.....||.||..
plant    63 GWRVEL-------SHKDKGGRGGGGGRRGGIEDSKCYECGELGHFARECRRGRGSVRRRSPSPRR 120

  Fly   218 NYRDRYDYRNDRYDRNLRRSPSRNRYT----RNRSYSR------SRSPQLRRTSSRY 264
            .....|.|.........||||.|.|..    |.|||||      ||....||..|.|
plant   121 RRSPDYGYARRSISPRGRRSPPRRRSVTPPRRGRSYSRSPPYRGSRRDSPRRRDSPY 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 15/74 (20%)
RSZ21NP_564208.1 RRM_SRSF3_like 3..70 CDD:409808 15/78 (19%)
zf-CCHC 90..104 CDD:395050 1/13 (8%)

Return to query results.
Submit another query.