DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and RBP45B

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_172630.1 Gene:RBP45B / 837708 AraportID:AT1G11650 Length:405 Species:Arabidopsis thaliana


Alignment Length:144 Identity:28/144 - (19%)
Similarity:54/144 - (37%) Gaps:41/144 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFC-FIYFEKLSDARAAKDSCSGIEVD 164
            |.||:.:.:...::.:|::||.|..:::....:       | |:.|.:.|.|..|....:|:::.
plant   265 VGGLDASVTDDHLKNVFSQYGEIVHVKIPAGKR-------CGFVQFSEKSCAEEALRMLNGVQLG 322

  Fly   165 GRRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASPYDNYRDRYDYRNDR 229
            |..:|:.:               ||.|..|                :|..|...|...|....::
plant   323 GTTVRLSW---------------GRSPSNK----------------QSGDPSQFYYGGYGQGQEQ 356

  Fly   230 YDRNLRRSPSRNRY 243
            |...:.:.|  |.|
plant   357 YGYTMPQDP--NAY 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 16/74 (22%)
RBP45BNP_172630.1 RRM1_SECp43_like 63..142 CDD:409780
RRM2_SECp43_like 154..233 CDD:409781
RRM_SF 260..331 CDD:473069 16/87 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.