DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and RBM4B

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_113680.1 Gene:RBM4B / 83759 HGNCID:28842 Length:359 Species:Homo sapiens


Alignment Length:254 Identity:50/254 - (19%)
Similarity:83/254 - (32%) Gaps:92/254 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARA 153
            |:...:||..:.|..::...:..::|..|.:|||:....:|.|        :.|::.|:..||..
Human    70 SKNKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKD--------YAFVHMERAEDAVE 126

  Fly   154 AKDSCSGIEVDGRRIRVDFSITQRAHTPTPGV----------------------YLGR------- 189
            |.......|..|:|:.|..| |.|..| .||:                      ..||       
Human   127 AIRGLDNTEFQGKRMHVQLS-TSRLRT-APGMGDQSGCYRCGKEGHWSKECPVDRTGRVADFTEQ 189

  Fly   190 --QPRGKAPRSFSPRRGRRVYHDRSASPYDNYRDRYDYRN------------------------- 227
              :..|.....::...|..:|::.:....|.|: ||..|:                         
Human   190 YNEQYGAVRTPYTMGYGESMYYNDAYGALDYYK-RYRVRSYEAVAAAAAASAYNYAEQTMSHLPQ 253

  Fly   228 ---------------DRYDRNL---------RRSPSRNRYTRNRSYSRSRSPQLRRTSS 262
                           |.|||:|         ..:.:....|.:..|.|.||| |||.::
Human   254 VQSTTVTSHLNSTSVDPYDRHLLPNSGAAATSAAMAAAAATTSSYYGRDRSP-LRRAAA 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 19/78 (24%)
RBM4BNP_113680.1 RRM1_RBM4 2..68 CDD:410018
RRM2_RBM4 78..144 CDD:410019 16/73 (22%)
PTZ00368 <145..>181 CDD:173561 6/37 (16%)
ZnF_C2HC 161..176 CDD:197667 0/14 (0%)
Interaction with TNPO3. /evidence=ECO:0000250 196..359 21/118 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.