DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and SR45a

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_563787.2 Gene:SR45a / 837246 AraportID:AT1G07350 Length:382 Species:Arabidopsis thaliana


Alignment Length:292 Identity:101/292 - (34%)
Similarity:126/292 - (43%) Gaps:84/292 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DRRSDYDYCGSRRHQRSSS-------RRRSRSRSSSESPPPEPRHRSGRSSRDRERMHKSREHPQ 94
            :.||...|  |||.:.|.|       |.||.|||.|.||.        ||      :....|:|.
plant    26 ENRSPMSY--SRRSRYSPSLSPYDKRRGRSVSRSLSRSPT--------RS------VSSDAENPG 74

  Fly    95 ASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCS 159
            .|  :.|.||:...::..:.:.|.|.|.:..:.:|:|..|:.||||.||..:.:.||.....|..
plant    75 NS--LYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLD 137

  Fly   160 GIEVDGRRIRVDFSITQRAHTPTPGVYLG-RQPRG--KAP-----------------------RS 198
            ...:.||.|.|:.:..:|..|||||.||| |..||  |:|                       ||
plant   138 HSVLQGRVITVEKARRRRGRTPTPGKYLGLRTARGRHKSPSYSPRRSVSCSRSRSRSYSSDRGRS 202

  Fly   199 FSP---RRG-----------RRVYH-DRSASPYDNY---RDR----YDYRNDR---YDRNLR--- 235
            :||   |||           ||.|. .||.||.|.|   |||    |..|.||   |.||.|   
plant   203 YSPSYGRRGRSSSYSPFYRRRRFYSPSRSPSPDDRYNRRRDRSYSPYYRRRDRSRSYSRNCRARD 267

  Fly   236 RSPSRNRYTRNRSYSRSRSPQLR---RTSSRY 264
            |||...|  |.||.|||.||:.|   |:.|.|
plant   268 RSPYYMR--RYRSRSRSYSPRYRARDRSCSPY 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 71/221 (32%)
RRM_TRA2 98..175 CDD:240809 22/76 (29%)
SR45aNP_563787.2 RRM <62..>151 CDD:223796 28/104 (27%)
RRM_SF 74..151 CDD:302621 23/78 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I2169
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001901
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48034
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.